Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr02790ggt1XFF4834R_chr02790putative gamma-glutamyltranspeptidase
  2. XFF4834R_chr03730bioFXFF4834R_chr03730probable 8-amino-7-oxononanoate synthase
  3. XFF4834R_chr11970ggt2XFF4834R_chr11970gamma-glutamyltranspeptidase
  4. XFF4834R_chr15290gshBXFF4834R_chr15290probable glutathione synthetase
  5. XFF4834R_chr25340ggt3XFF4834R_chr25340gamma-glutamyltranspeptidase

ggt1 XFF4834R_chr02790
XFF4834R_chr02780
XFF4834R_chr02780
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02800
XFF4834R_chr02800
ID ggt1
AC XFF4834R_chr02790
LT XFF4834R_chr02790
OR XFF4834R_chr from 324758 to 326338 on strand -
DE putative gamma-glutamyltranspeptidase
IP Gamma-glutamyltranspeptidase
CL 1.5.3.10 Glutathione GO:0006750
EC
GO InterPro
Molecular Function: gamma-glutamyltransferase activity (GO:0003840)

Curated
PM
AN according to E. coli annotation
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 55509.2 Da
SQ 526 aa
 
........10........20........30........40........50
| | | | |
MLHTLRARRGMVVAPHHLAAQAGRDVLRDGGTAIEAAVATAACLAVVYPH
MTGIGGDGFWLIHEPDGRVHAIDACGRAAHAATLDFYRGHAHIPWRGPGA
ANTVAGTVSGWALALQQASGGLSLQRLLSDAIHHASAGVPVTLGGAQIAA
SKGAELRPQPGAYSEIFEPHGALLQEGALLQQPQLARSLQRLADEGLEGF
YRGSLAHDIAADLHALGSPLSAHDLAAHHAEASVPLSVALRGARLYNHAP
PTQGLASLLILALFDRLKVESADSHAHLHGLIEASKQAFLIRDAHLGDPA
WMTLDPQALLDDNAALDALAARIDMSAALPWPQPSQAGDTVWFGAIDAYG
RAVSCIQSTYFEFGSGLVLPRTGITWQNRGCSFRLAPDGWNALAPGRKPF
HTLNPALATFDDGRVMAYGTMGGEGQPQTQAAVFSRYARFGMPLQQAVSA
PRWLLGRTWGEDSTSLKLENRFDPAVVHALRNAGHAVELLPVYSSVMGHA
GALVRERDGILSGASDPRSDGAVAAW
XFF4834R

XFF4834R_chr11970 lcl|XFF4834R_chr12560320_1347029_f3_XFF4834R-XFF4834R_chr11970

7

526

S=468 I=31 E=6.21694e-50

XFF4834R

XFF4834R_chr25340 lcl|ggt-XFF4834R_chr25340

12

519

S=218 I=25 E=1.22858e-19

gamma-glutamyltranspeptidase

XFF4834R

NP_640661.1 lcl|ggt-XAC0305

1

526

S=2262 I=85 E=0

gamma-glutamyltranspeptidase

XFF4834R

YP_362045.1 lcl|ggt1-XCV0314

1

526

S=2209 I=82 E=0

gamma-glutamyltranspeptidase

XFF4834R

NP_635686.1 lcl|ggt-XCC0291

1

526

S=2026 I=76 E=0

gamma-glutamyltranspeptidase

XFF4834R

NP_643757.1 lcl|ggt-XAC3450

7

526

S=469 I=31 E=1.53248e-49

gamma-glutamyltranspeptidase

XFF4834R

YP_365309.1 lcl|XCV3578

7

526

S=465 I=31 E=5.23954e-49

gamma-glutamyltranspeptidase precursor

XFF4834R

NP_638668.1 lcl|ggt-XCC3322

7

526

S=459 I=31 E=3.1027e-48

gamma-glutamyltranspeptidase

XFF4834R

lcl|ggt-XALc_1940

16

489

S=226 I=25 E=4.07687e-20

putative gamma-glutamyltranspeptidase; protein

XFF4834R

NP_637742.1 lcl|ggt-XCC2388

12

519

S=222 I=25 E=1.43081e-19

gamma-glutamyltranspeptidase

XFF4834R

YP_364437.1 lcl|ggt2-XCV2706

12

519

S=218 I=25 E=3.86585e-19

gamma-glutamyltranspeptidase precursor

XFF4834R

NP_642838.1 lcl|ggt-XAC2523

12

519

S=208 I=25 E=6.80777e-18

gamma-glutamyltranspeptidase

pubmed

7

526

S=1147 I=49 E=5.14742e-130

Putative oxamate amidohydrolase

Pubmed 19060149

 

prodomImg

pubmed

1

522

S=814 I=37 E=1.0176e-89

Putative gamma-glutamyltransferase ywrD EC=2.3.2.2 ; Acyltransferase Zymogen

Pubmed 9353933

 

prodomImg

pubmed

4

521

S=492 I=28 E=1.15236e-50

Gamma-glutamyltransferase

Pubmed 17971441

 

prodomImg

pubmed

9

521

S=466 I=30 E=1.67232e-47

ANL50 Gamma-glutamyltranspeptidase Gamma-glutamyltranspeptidase SrpE ; Plasmid

Pubmed 18353436

 

prodomImg

pubmed

1

519

S=402 I=26 E=9.59112e-40

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

Pubmed 2570061

 

prodomImg

pubmed

7

467

S=341 I=25 E=2.07171e-32

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

Pubmed 7765305

 

prodomImg

pubmed

6

452

S=324 I=25 E=2.68658e-30

Gamma-glutamyl transpeptidase

Pubmed 17991023

 

prodomImg

pubmed

8

522

S=316 I=23 E=2.1213e-29

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

Pubmed 8763966

 

prodomImg

pubmed

8

492

S=296 I=24 E=6.75275e-27

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

Pubmed 9339568,1371053

 

prodomImg

pubmed

9

526

S=295 I=26 E=7.9002e-27

Gamma-glutamyltranspeptidase 1 EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Glycoprotein Membrane Signal-anchor Transmembrane Zymogen

Pubmed 8566783

 

prodomImg

Iprscan IPR000101 [PF01019]

24

521

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [TIGR00066]

10

518

Gamma-glutamyltranspeptidase

Iprscan [seg]

33

47

-

Iprscan [seg]

172

186

-

Iprscan [seg]

205

216

-

Iprscan [seg]

304

324

-

PDA1O4U0

60

105

S=169 I=75 E=6.41531e-13

PD944993

412

469

S=136 I=46 E=6.62084e-09

PD002629

341

414

S=118 I=37 E=1.14482e-06

PDA55948

1

59

S=117 I=46 E=1.55334e-06

PD763364

472

522

S=112 I=50 E=5.12881e-06

PDA7B0E6

470

526

S=111 I=42 E=7.8624e-06

PD857339

484

521

S=107 I=53 E=2.59601e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one a8OEEtT7)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

64 hits
swiss-prot

Swiss-Prot ncbi-blastp

19 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr02790.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr02790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr02790.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr02790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
bioF XFF4834R_chr03730
XFF4834R_chr03720
XFF4834R_chr03720
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03740
XFF4834R_chr03740
ID bioF
AC XFF4834R_chr03730
LT XFF4834R_chr03730
OR XFF4834R_chr from 423395 to 424612 on strand -
DE probable 8-amino-7-oxononanoate synthase
IP 8-amino-7-oxononanoate synthase; Aminotransferases, class-I, pyridoxal-phosphate-binding site
CL 1.5.3.10 Glutathione GO:0006750
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Biological Process: biotin biosynthetic process (GO:0009102)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: 8-amino-7-oxononanoate synthase activity (GO:0008710)
transferring nitrogenous groups (GO:0016769)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 43505.5 Da
SQ 405 aa
 
........10........20........30........40........50
| | | | |
MNAPMARPDLHERISSLRKLRVAQERVRVRRQVGRRDGVRLEIDGRWLTG
FCSNDYLGLSQQFEVVAALQDAAARDGAGATASHLICGHHTAHETLEREI
AEWLGYPSALLFGSGFIANLAVQQALLSEEDDVCVQDRLNHASLLDATRL
AGCRLRRYPHLDVEGAMRQLKGAPEGAAMLATDGVFSMDGDVAPLRALSL
VARMQQALFYVDDAHGVGVLGPQGRGCVADAGLGVAEVPLQLVTLGKALG
GYGAVVVGEEALVRHLAETARPYIYTTALPPAQVAATLAAVRLARRDDWR
RARLVELIGAFRDGARKHGFELMASDTPIQPLLCGEEATVMAMSAALGHA
GFMVGAIRPPTVPEGKARLRITLSALHTPQQVQALIEAIVQARDVVSRQP
LRASA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr10220 lcl|kbl-XFF4834R_chr10220

44

391

S=365 I=28 E=1.14317e-37

glycine C-acetyltransferase

XFF4834R

XFF4834R_chr10220 lcl|kbl-XFF4834R_chr10220

44

391

S=365 I=28 E=1.14317e-37

glycine C-acetyltransferase

pubmed

46

389

S=507 I=38 E=1.23289e-52

7-KAPA synthetase ; Pyridoxal phosphate Transferase

Pubmed 11133432

 

prodomImg

pubmed

44

389

S=506 I=41 E=1.36887e-52

Putative 8-amino-7-oxononanoate synthase ; Pyridoxal phosphate Transferase

Pubmed 16054111

 

prodomImg

pubmed

44

389

S=490 I=37 E=1.43998e-50

KAPA synthetase BioF ; Pyridoxal phosphate Transferase

Pubmed 11133432

 

prodomImg

pubmed

44

389

S=487 I=37 E=3.53482e-50

8-amino-7-oxononanoate synthase EC=2.3.1.47 ; Biotin biosynthesis Pyridoxal phosphate Transferase

Pubmed 3058702

 

prodomImg

pubmed

45

389

S=475 I=37 E=1.00551e-48

8-amino-7-oxononanoate synthase EC=2.3.1.47 ; Biotin biosynthesis Pyridoxal phosphate Transferase

Pubmed 9063571

 

prodomImg

pubmed

44

389

S=460 I=37 E=5.1747e-47

KAPA-synthetase ; Pyridoxal phosphate Transferase

Pubmed 11133432

 

prodomImg

pubmed

41

389

S=423 I=35 E=1.63025e-42

8-amino-7-oxononanoate synthase EC=2.3.1.47 ; Biotin biosynthesis Pyridoxal phosphate Transferase

Pubmed 8250549

 

prodomImg

pubmed

43

389

S=418 I=31 E=6.4643e-42

8-amino-7-oxononanoate synthase EC=2.3.1.47 ; Biotin biosynthesis Pyridoxal phosphate Transferase

Pubmed 2110099,1575677

 

prodomImg

pubmed

48

391

S=405 I=31 E=2.81889e-40

2-amino-3-ketobutyrate coenzyme A ligase, mitochondrial EC=2.3.1.29 ; Acyltransferase Mitochondrion Pyridoxal phosphate Transit peptide

Pubmed 10712613

 

prodomImg

pubmed

43

387

S=400 I=28 E=1.07007e-39

KAPA synthase ; Pyridoxal phosphate Transferase

Pubmed 11255013

 

prodomImg

sp_Pdown

sp|Q9I617|BIOF_PSEAE

43

389

S=607 I=42 E=6.31602e-65

8-amino-7-oxononanoate synthase EC=2.3.1.47 ; Biotin biosynthesis Pyridoxal phosphate Transferase

sp_Pdown

sp|P12998|BIOF_ECOLI

44

389

S=487 I=37 E=2.43254e-50

8-amino-7-oxononanoate synthase EC=2.3.1.47 ; Biotin biosynthesis Pyridoxal phosphate Transferase

sp_Pdown

sp|Q47829|BIOF_ENTAG

45

389

S=475 I=37 E=6.91956e-49

8-amino-7-oxononanoate synthase EC=2.3.1.47 ; Biotin biosynthesis Pyridoxal phosphate Transferase

sp_Pdown

sp|Q89AK6|BIOF_BUCBP

41

394

S=470 I=30 E=2.44975e-48

8-amino-7-oxononanoate synthase EC=2.3.1.47 ; Biotin biosynthesis Pyridoxal phosphate Transferase

sp_Pdown

sp|P36570|BIOF_SERMA

41

389

S=423 I=35 E=1.12188e-42

8-amino-7-oxononanoate synthase EC=2.3.1.47 ; Biotin biosynthesis Pyridoxal phosphate Transferase

Iprscan IPR015421 [G3DSA:3.40.640.10]

64

295

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan [PTHR13693]

51

403

-

Iprscan IPR004839 [PF00155]

49

389

Aminotransferase, class I/II

Iprscan IPR004723 [TIGR00858]

26

390

8-amino-7-oxononanoate synthase

Iprscan [seg]

21

40

-

Iprscan [seg]

67

82

-

Iprscan [seg]

245

263

-

Iprscan [seg]

277

304

-

PD001038

311

393

S=183 I=45 E=1.02459e-14

PDA102A7

92

233

S=123 I=29 E=2.02835e-07

PDA181X6

182

218

S=116 I=59 E=1.54668e-06

PD331580

104

164

S=113 I=43 E=3.18918e-06

Iprscan IPR015424 [SSF53383]

9

392

Pyridoxal phosphate-dependent transferase, major domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eNGN5JdS)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

107 hits
swiss-prot

Swiss-Prot ncbi-blastp

87 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr03730.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr03730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr03730.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr03730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ggt2 XFF4834R_chr11970
XFF4834R_chr_1281
XFF4834R_chr_1281
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11980
XFF4834R_chr11980
ID ggt2
AC XFF4834R_chr11970
LT XFF4834R_chr11970
OR XFF4834R_chr from 1345320 to 1347029 on strand +
DE gamma-glutamyltranspeptidase
IP Gamma-glutamyltranspeptidase
CL 1.5.3.10 Glutathione GO:0006750
EC
GO InterPro
Molecular Function: gamma-glutamyltransferase activity (GO:0003840)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 61643.6 Da
SQ 569 aa
 
........10........20........30........40........50
| | | | |
MRRVPVLLVSALALLAPPLGAADRVTGQPFATRSEVIAPHAMAATSQPLA
TQIALEVMKDGGSAVDAAIAANAALGLMEPTGNGVGGDLFAIVWDPKTHK
LYGYNGSGRSPKSLTLAEFQRRGLKDIPPTGPLPVSVPGVVDGWFALHER
FGRKPMAQNLAPAIRYAREGHPVAETIAYYWDRSVPRLSQYPGFKEQFTI
DGHAPRKGELWKNPNLANTLQQIADGGRDAFYKGDIARTIGAYFKANGGY
LSYEDLASHTGEWVEPVSTNYRGVDVWELPPNSQGIAALQMLNILEGYDF
SKIPFGSAEHVHLFTEAKKLAFADRARFYADPAFQPAPLARLISKDYANQ
RRALISMDKALKQVQPGTPKQLEEGDTIYMTVADADGMMVSLIQSNYRGM
GSGMAPPGLGFILQDRGEMFVLKKDHPNGYAPGKRPFQTIIPAFVTKDGK
PWLSFGVMGGAMQPQGHVQIVMNLVDFHMNLQEAGDAPRIQHEGSTEPTG
QATAMSDGGEVNLETGFSYDTIRALMRKGHRVIFADGPYGGYQAIARDLV
SGVYYGASESRKDGQAAGY
XFF4834R

XFF4834R_chr02790 lcl|XFF4834R_chr02920758_0326338_r3_XFF4834R-XFF4834R_chr02790

31

569

S=538 I=34 E=2.1491e-58

XFF4834R

XFF4834R_chr25340 lcl|ggt-XFF4834R_chr25340

39

493

S=534 I=34 E=6.61783e-58

gamma-glutamyltranspeptidase

XFF4834R

NP_643757.1 lcl|ggt-XAC3450

23

569

S=2793 I=97 E=0

gamma-glutamyltranspeptidase

XFF4834R

YP_365309.1 lcl|XCV3578

23

569

S=2786 I=96 E=0

gamma-glutamyltranspeptidase precursor

XFF4834R

NP_638668.1 lcl|ggt-XCC3322

23

569

S=2737 I=94 E=0

gamma-glutamyltranspeptidase

XFF4834R

YP_362045.1 lcl|ggt1-XCV0314

31

569

S=546 I=33 E=8.23351e-59

gamma-glutamyltranspeptidase

XFF4834R

NP_637742.1 lcl|ggt-XCC2388

39

493

S=535 I=34 E=1.9333e-57

gamma-glutamyltranspeptidase

XFF4834R

YP_364437.1 lcl|ggt2-XCV2706

39

493

S=523 I=33 E=4.70068e-56

gamma-glutamyltranspeptidase precursor

XFF4834R

NP_642838.1 lcl|ggt-XAC2523

39

493

S=523 I=33 E=5.59617e-56

gamma-glutamyltranspeptidase

XFF4834R

NP_635686.1 lcl|ggt-XCC0291

31

569

S=521 I=33 E=1.03928e-55

gamma-glutamyltranspeptidase

XFF4834R

lcl|ggt-XALc_1940

44

461

S=519 I=34 E=1.48587e-55

putative gamma-glutamyltranspeptidase; protein

XFF4834R

NP_640661.1 lcl|ggt-XAC0305

31

569

S=519 I=33 E=1.48587e-55

gamma-glutamyltranspeptidase

pubmed

29

569

S=1043 I=43 E=1.78898e-117

Gamma-glutamyltransferase

Pubmed 17971441

 

prodomImg

pubmed

33

569

S=811 I=38 E=2.75011e-89

ANL50 Gamma-glutamyltranspeptidase Gamma-glutamyltranspeptidase SrpE ; Plasmid

Pubmed 18353436

 

prodomImg

pubmed

36

568

S=793 I=37 E=4.02931e-87

Putative gamma-glutamyltransferase ywrD EC=2.3.2.2 ; Acyltransferase Zymogen

Pubmed 9353933

 

prodomImg

pubmed

42

564

S=619 I=34 E=4.71351e-66

Acylase ACY 1 EC=3.5.1.- EC=2.3.2.2 ; Acyltransferase Antibiotic resistance Hydrolase Zymogen

Pubmed 3680178

 

prodomImg

pubmed

42

564

S=618 I=33 E=5.61144e-66

Acylase ACY 1 EC=3.5.1.- EC=2.3.2.2 ; Acyltransferase Antibiotic resistance Hydrolase Zymogen

Pubmed 1358202

 

prodomImg

pubmed

36

569

S=602 I=32 E=5.13433e-64

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

Pubmed 2570061

 

prodomImg

pubmed

42

493

S=575 I=31 E=9.10553e-61

Gamma-glutamyltranspeptidase

Pubmed 14764109

 

prodomImg

pubmed

42

500

S=575 I=32 E=9.51125e-61

Gamma-glutamyltranspeptidase EC=2.3.2.2 Gamma-glutamyl transpeptidase ; Acyltransferase

Pubmed 17600669

 

prodomImg

pubmed

42

500

S=573 I=32 E=1.60483e-60

Gamma-glutamyltranspeptidase

Pubmed 16861657

 

prodomImg

pubmed

31

515

S=572 I=31 E=2.41765e-60

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

Pubmed 7765305

 

prodomImg

Iprscan IPR000101 [PF01019]

55

564

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [TIGR00066]

41

561

Gamma-glutamyltranspeptidase

Iprscan [seg]

4

22

-

Iprscan [seg]

64

74

-

PD691723

248

379

S=282 I=47 E=1.17503e-26

PD127336

135

240

S=179 I=43 E=4.11851e-14

PD944993

448

489

S=172 I=79 E=2.43886e-13

PD948146

496

569

S=160 I=49 E=6.87731e-12

PD002629

378

450

S=150 I=41 E=1.34467e-10

PDA55958

30

110

S=137 I=41 E=5.18994e-09

PDA0V172

91

136

S=131 I=56 E=2.2849e-08

PD566498

32

90

S=110 I=41 E=9.5308e-06

PDA55940

88

122

S=106 I=51 E=2.62038e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AYKvbMh4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

85 hits
swiss-prot

Swiss-Prot ncbi-blastp

25 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr11970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr11970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr11970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr11970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
gshB XFF4834R_chr15290
XFF4834R_chr15280
XFF4834R_chr15280
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15300
XFF4834R_chr15300
ID gshB
AC XFF4834R_chr15290
LT XFF4834R_chr15290
OR XFF4834R_chr from 1756433 to 1757383 on strand -
DE probable glutathione synthetase
IP Prokaryotic glutathione synthetase, N-terminal; Prokaryotic glutathione synthetase, ATP-binding; Pre-ATP-grasp fold; Phosphoribosylaminoimidazole carboxylase
CL 1.5.3.10 Glutathione GO:0006750
EC
GO InterPro
Biological Process: glutathione biosynthetic process (GO:0006750)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: glutathione synthase activity (GO:0004363)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [HJ] Coenzyme transport and metabolism;Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100412)
MW 34312.1 Da
SQ 316 aa
 
........10........20........30........40........50
| | | | |
MSLDVVVVMDPIASIKIAKDTTFAMLLEAQRRGHRLQYVRPGGLSLREGR
AVAQVAPLSVREDKTSWFTLGEFAELAFGPGQVVLMRKDPPVDAEFVYDT
QVLSVAQRAGAQIVNDPQGLRDYNEKLAALLFPQCCPPTLVSRDAAALKA
FVLDHGQAVLKPLDGMGGRSIFRSGSGDPNLNVILETLTDGNRKLTLAQR
FIPDITAGDKRILLVDGVPVDYCLARIPQGDEFRGNLAAGGRGEGRPLSE
RDRWIAAQVGPEMRRRGMRFVGLDVIGDYLTEVNVTSPTCVRELDAQFGL
NIAGLLFDAIEAGAAR
XFF4834R

NP_643412.1 lcl|gshB-XAC3103

1

316

S=1624 I=99 E=0

glutathione synthetase

XFF4834R

YP_364965.1 lcl|gshB-XCV3234

1

316

S=1605 I=98 E=0

glutathione synthetase

XFF4834R

NP_638274.1 lcl|gshB-XCC2926

1

316

S=1571 I=95 E=0

glutathione synthetase

XFF4834R

lcl|RimK-XALc_2243

1

316

S=1481 I=90 E=1.98263e-172

putative glutathione synthetase protein

pubmed

7

312

S=907 I=57 E=2.81256e-101

Glutathione synthetase EC=6.3.2.3 ; ATP-binding biosynthesis Ligase Magnesium Manganese Metal-binding Nucleotide-binding

Pubmed 6393055

 

prodomImg

pubmed

4

315

S=622 I=43 E=9.51132e-67

Glutathione synthetase

Pubmed 10692382

 

prodomImg

pubmed

3

312

S=579 I=40 E=1.4269e-61

Glutathione synthetase EC=6.3.2.3 ; ATP-binding biosynthesis Ligase Magnesium Manganese Metal-binding Nucleotide-binding

Pubmed 9308172

 

prodomImg

pubmed

3

311

S=498 I=35 E=1.04289e-51

Glutathione synthetase EC=6.3.2.3 ; ATP-binding biosynthesis Ligase Magnesium Manganese Metal-binding Nucleotide-binding

Pubmed 7557485

 

prodomImg

pubmed

3

311

S=402 I=32 E=5.14004e-40

Glutathione synthetase EC=6.3.2.3 ; ATP-binding biosynthesis Ligase Magnesium Manganese Metal-binding Nucleotide-binding

Pubmed 1540152

 

prodomImg

pubmed

129

286

S=333 I=44 E=9.64894e-32

Glutathione synthetase

Pubmed 15926088

 

prodomImg

sp_Pdown

sp|Q8PHZ5|GSHB_XANAC

1

316

S=1624 I=99 E=0

Glutathione synthetase EC=6.3.2.3 ; ATP-binding biosynthesis Ligase Magnesium Manganese Metal-binding Nucleotide-binding

sp_Pdown

sp|Q8P6P1|GSHB_XANCP

1

316

S=1571 I=95 E=0

Glutathione synthetase EC=6.3.2.3 ; ATP-binding biosynthesis Ligase Magnesium Manganese Metal-binding Nucleotide-binding

sp_Pdown

sp|Q87D42|GSHB_XYLFT

1

313

S=1335 I=78 E=2.76817e-153

Glutathione synthetase EC=6.3.2.3 ; ATP-binding biosynthesis Ligase Magnesium Manganese Metal-binding Nucleotide-binding

sp_Pdown

sp|Q9PC29|GSHB_XYLFA

1

314

S=1331 I=77 E=9.30072e-153

Glutathione synthetase EC=6.3.2.3 ; ATP-binding biosynthesis Ligase Magnesium Manganese Metal-binding Nucleotide-binding

sp_Pdown

sp|Q88D35|GSHB_PSEPK

1

311

S=938 I=59 E=3.90292e-105

Glutathione synthetase EC=6.3.2.3 ; ATP-binding biosynthesis Ligase Magnesium Manganese Metal-binding Nucleotide-binding

Iprscan IPR013817 [G3DSA:3.40.50.20]

2

131

Pre-ATP-grasp fold

Iprscan IPR013816 [G3DSA:3.30.470.20]

181

301

ATP-grasp fold, subdomain 2

Iprscan IPR006284 [MF_00162]

3

314

Glutathione synthetase, prokaryotic

Iprscan IPR004218 [PF02955]

125

299

Prokaryotic glutathione synthetase, ATP-binding

Iprscan IPR004215 [PF02951]

3

121

Prokaryotic glutathione synthetase, N-terminal

Iprscan IPR006284 [TIGR01380]

3

314

Glutathione synthetase, prokaryotic

Iprscan IPR011761 [PS50975]

124

311

ATP-grasp fold

PD500802

10

122

S=316 I=53 E=8.1625e-31

PD432181

151

252

S=308 I=59 E=7.60621e-30

PD863335

251

303

S=201 I=66 E=6.26523e-17

PDA5S2R3

3

156

S=168 I=31 E=7.11678e-13

PDA195N4

101

155

S=132 I=45 E=1.75642e-08

Iprscan [SSF56059]

124

312

-

Iprscan IPR016185 [SSF52440]

3

123

PreATP-grasp-like fold

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 9F2UvfGX)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

63 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr15290.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr15290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr15290.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr15290.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ggt3 XFF4834R_chr25340
XFF4834R_chr_2684
XFF4834R_chr_2684
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25350
XFF4834R_chr25350
ID ggt3
AC XFF4834R_chr25340
LT XFF4834R_chr25340
OR XFF4834R_chr from 2925507 to 2927285 on strand -
DE gamma-glutamyltranspeptidase
IP Gamma-glutamyltranspeptidase
CL 1.5.3.10 Glutathione GO:0006750
EC
GO InterPro
Molecular Function: gamma-glutamyltransferase activity (GO:0003840)

Curated
PM
AN Signal peptide predicted by Phobius.
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 62601.3 Da
SQ 592 aa
 
........10........20........30........40........50
| | | | |
MSTFSRRFSSRGVLLLAFVLAPAAWCADAAKPATATTAAVAAHPPGAAIA
SGHALATDAGLQVLREGGNAFDAAVAVSSTLAVVEPISSGLGGGGFFLLH
DAKTGKDVMLDARETAPASATEAQFLDKKGELDRDRSVNGPWSAGIPGLP
AALVELAAKHGRLPLKQSLAPSIRIATEGFPVYARMANGYASRREVMERY
PGTREVYLRGGKPIAEGEIFKQPELAQTLQLLGDKGFDGFYKGETARKLL
AGVKQAGGQWSAAELAGYRVKERAPIQFDYRGWKITTAPPPSSGGIALAA
MLQILEGWDLNTLDDVHRTHLVVESMRRAYRDRTFFLGDPDFVDVPQRVL
TSKDYAQGLRATINPDKATPSDLLSGNPTPLEDDETTHFSIIDGEGNRVG
ATQTVNLLYGSGLIPKGTGVLLNNEMDDFALKPGTPNAFGVMGYAANAPK
PGKRMLSSMTPTFMESADKAIVLGTPGGSRIITMVLLGVLGYDAGLDAQA
VSALPRYHHQWLPDVIEAETDAFSAQTAKGLQAMGHALELPGDTAEGGRG
SSHVWGNLQTVEWDKRSNVLSGGSDPRNPVGKAQVQLDAAAH
XFF4834R

XFF4834R_chr11970 lcl|XFF4834R_chr12560320_1347029_f3_XFF4834R-XFF4834R_chr11970

55

510

S=510 I=33 E=5.81692e-55

XFF4834R

XFF4834R_chr02790 lcl|XFF4834R_chr02920758_0326338_r3_XFF4834R-XFF4834R_chr02790

161

578

S=303 I=29 E=6.90128e-30

XFF4834R

XFF4834R_chr11970 lcl|XFF4834R_chr12560320_1347029_f3_XFF4834R-XFF4834R_chr11970

55

510

S=510 I=33 E=5.81692e-55

XFF4834R

XFF4834R_chr02790 lcl|XFF4834R_chr02920758_0326338_r3_XFF4834R-XFF4834R_chr02790

161

578

S=303 I=29 E=6.90128e-30

pubmed

51

592

S=2253 I=78 E=0

Putative uncharacterized protein ggt

Pubmed 16102911

 

prodomImg

pubmed

54

540

S=885 I=38 E=2.64547e-98

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

Pubmed 2570061

 

prodomImg

pubmed

55

541

S=877 I=39 E=2.71331e-97

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

Pubmed 7765305

 

prodomImg

pubmed

51

538

S=860 I=40 E=3.36851e-95

Gamma-glutamyltranspeptidase

Pubmed 14764109

 

prodomImg

pubmed

55

583

S=849 I=39 E=7.12384e-94

Gamma-glutamyl transpeptidase

Pubmed 17991023

 

prodomImg

pubmed

51

538

S=842 I=37 E=5.2004e-93

Gamma-glutamyltranspeptidase

Pubmed 16861657

 

prodomImg

pubmed

51

538

S=842 I=37 E=5.38497e-93

Gamma-glutamyltranspeptidase EC=2.3.2.2 Gamma-glutamyl transpeptidase ; Acyltransferase

Pubmed 17600669

 

prodomImg

pubmed

51

575

S=681 I=33 E=1.44458e-73

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

Pubmed 8763966

 

prodomImg

pubmed

105

540

S=660 I=36 E=5.57087e-71

Uvs048

Pubmed 14532085

 

prodomImg

pubmed

51

536

S=658 I=34 E=1.00787e-70

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

Pubmed 9339568,1371053

 

prodomImg

sp_Pdown

sp|P18956|GGT_ECOLI

54

540

S=885 I=38 E=1.8218e-98

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

sp_Pdown

sp|P36267|GGT_PSEUA

55

541

S=877 I=39 E=1.86852e-97

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

sp_Pdown

sp|Q9I406|GGT_PSEAE

62

539

S=780 I=40 E=9.37127e-86

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Periplasm Signal Zymogen

sp_Pdown

sp|P54422|GGT_BACSU

51

575

S=681 I=33 E=9.94806e-74

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

sp_Pdown

sp|P63186|GGT_BACNA

51

536

S=658 I=34 E=6.94071e-71

Gamma-glutamyltranspeptidase EC=2.3.2.2 ; Acyltransferase Glutathione biosynthesis Secreted Signal Zymogen

Iprscan IPR000101 [PR01210]

69

94

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

143

161

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

161

180

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

259

275

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

289

308

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

386

404

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

410

428

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

451

466

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PR01210]

474

491

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PTHR11686]

43

582

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [PF01019]

62

578

Gamma-glutamyltranspeptidase

Iprscan IPR000101 [TIGR00066]

47

577

Gamma-glutamyltranspeptidase

Iprscan [seg]

13

50

-

Iprscan [seg]

73

84

-

Iprscan [seg]

90

99

-

Iprscan [SignalP-NN(euk)]

1

29

-

PD691723

257

389

S=277 I=46 E=5.27809e-26

PD859962

521

586

S=258 I=71 E=1.10562e-23

PD002629

387

469

S=247 I=55 E=2.21902e-22

PD127336

145

258

S=167 I=38 E=1.15434e-12

PD335414

471

519

S=134 I=50 E=1.18098e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one EyDI2Wje)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

68 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr25340.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr25340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr25340.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBnXtUsY/XFF4834R_chr25340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.