Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr02820addXFF4834R_chr02820probable adenosine deaminase

add XFF4834R_chr02820
XFF4834R_chr02810
XFF4834R_chr02810
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02830
XFF4834R_chr02830
ID add
AC XFF4834R_chr02820
LT XFF4834R_chr02820
OR XFF4834R_chr from 329274 to 330650 on strand -
DE probable adenosine deaminase
IP Adenosine/AMP deaminase
CL 1.5.2.3 Purine ribonucleotide biosynthesis GO:0009152
EC
GO InterPro
Biological Process: purine ribonucleoside monophosphate biosynthetic process (GO:0009168)
Molecular Function: deaminase activity (GO:0019239)

Curated
PM
AN changement de start - 60a.a
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: acur
CC STATUS: curated by brin (20100903)
MW 49974.2 Da
SQ 458 aa
 
........10........20........30........40........50
| | | | |
MPKGGDLHNHLSGSVYAETYLQWASDDGACVQLDELSLRAPPCGAGQEPA
SGLAARNAALYGRMVNSLSMRNFLPGPAQPSGHDQFFSTFGKFDVVVRTR
VADTVAAVLEQAARDRVPYVEIIANPPQMDQAAKRMQSLPWKGEDDAANL
RALQPDLAPLVQAAQRDLADIDAQVRRVLRCDQADARPGCTVEYRYVPYV
LRVLPQPMVFGQMALAHALIAAGGSRAVALNIVAPEDNPVALADYARHMA
MFRFFAARYPGVPLSLHAGELALGLVPPAQLRSHIRQAVDAGARRIGHGV
DLPYEDDAEALLQRMRREQVAVEINLTSNDVILGIKGAAHPLALYLRAGV
PVVLSTDDAGVSRADMTHEYQRAMQEQGIDYPSLKQLARNGLRYSFLPGA
SLWDADGKAAQACATALQRETDDAACRAFREGSEKARLQWQLETDLAQYE
RTLLLQHR
XFF4834R

NP_640664.2 add-XAC0308

1

458

S=2192 I=92 E=0

adenosine deaminase

XFF4834R

NP_635689.2 add-XCC0294

1

458

S=1915 I=80 E=0

adenosine deaminase

XFF4834R

YP_362048.1 add-XCV0317

70

458

S=1797 I=89 E=0

putative adenosine deaminase

pubmed

261

397

S=173 I=37 E=4.18108e-12

Adenosine deaminase EC=3.5.4.4 ; Hydrolase Nucleotide metabolism

Pubmed 1998686

 

prodomImg

pubmed

264

398

S=169 I=35 E=1.35665e-11

Adenosine deaminase-related growth factor-like protein

Pubmed 17439545

 

prodomImg

pubmed

262

438

S=151 I=29 E=1.82172e-09

Adenosine deaminase-related growth factor A Adenosine deaminase-related growth factor A, isoform A EC=3.5.4.4 Adenosine deaminase-related

Pubmed 17893096

 

prodomImg

pubmed

261

413

S=143 I=31 E=1.74256e-08

Putative adenosine deaminase

Pubmed 12213246

 

prodomImg

pubmed

262

399

S=141 I=33 E=3.18021e-08

AT15281p Adenosine deaminase-related growth factor B

Pubmed 11738815

 

prodomImg

sp_Pdown

sp|Q0HPH4|ADD_SHESR

287

397

S=178 I=38 E=7.42442e-13

Adenosine deaminase EC=3.5.4.4 ; Hydrolase Nucleotide metabolism

sp_Pdown

sp|B7NU11|ADD_ECO7I

261

397

S=177 I=37 E=1.04313e-12

Adenosine deaminase EC=3.5.4.4 ; Hydrolase Nucleotide metabolism

sp_Pdown

sp|B1LER3|ADD_ECOSM

264

397

S=175 I=37 E=1.79102e-12

Adenosine deaminase EC=3.5.4.4 ; Hydrolase Nucleotide metabolism

sp_Pdown

sp|B6IB57|ADD_ECOSE

261

397

S=174 I=37 E=2.15088e-12

Adenosine deaminase EC=3.5.4.4 ; Hydrolase Nucleotide metabolism

sp_Pdown

sp|B5Z457|ADD_ECO5E

261

397

S=174 I=37 E=2.51636e-12

Adenosine deaminase EC=3.5.4.4 ; Hydrolase Nucleotide metabolism

Iprscan [G3DSA:3.20.20.140]

6

398

-

Iprscan [PTHR11409:SF21]

254

398

-

Iprscan IPR001365 [PTHR11409]

254

398

Adenosine/AMP deaminase

Iprscan IPR001365 [PF00962]

257

398

Adenosine/AMP deaminase

Iprscan [seg]

94

108

-

Iprscan [seg]

246

258

-

PD604047

70

245

S=480 I=53 E=1.43796e-50

PD616327

399

458

S=294 I=93 E=4.19838e-28

PDA1T4W2

363

451

S=187 I=43 E=3.74049e-15

PD008716

262

397

S=146 I=36 E=3.53505e-10

PDA0U3A6

1

69

S=138 I=38 E=3.68949e-09

Iprscan [SSF51556]

1

398

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one POtOZIdQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

109 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxpKpc4/XFF4834R_chr02820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxpKpc4/XFF4834R_chr02820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxpKpc4/XFF4834R_chr02820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBxpKpc4/XFF4834R_chr02820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.