Xanthomonas fuscans subsp. fuscans

8 hits

  1. XFF4834R_chr17230pyrBXFF4834R_chr17230probable aspartate carbamoyltransferase, catalytic subunit
  2. XFF4834R_chr19340pyrDXFF4834R_chr19340 probable dihydro-orotate oxidase, FMN-linked
  3. XFF4834R_chr23650pyrCXFF4834R_chr23650probable Dihydroorotase
  4. XFF4834R_chr27950pyrGXFF4834R_chr27950probable CTP synthetase
  5. XFF4834R_chr30780pyrHXFF4834R_chr30780probable uridylate kinase
  6. XFF4834R_chr37900pyrEXFF4834R_chr37900probable orotate phosphoribosyltransferase
  7. XFF4834R_chr39340XFF4834R_chr42550972_4531916_f3_XFF4834R-XFF4834R_chr39340XFF4834R_chr39340putative 2-dehydropantoate 2-reductase
  8. XFF4834R_chr41420pyrFXFF4834R_chr41420probable orotidine-5'-phosphate decarboxylase

pyrB XFF4834R_chr17230
XFF4834R_chr17230
XFF4834R_chr17230
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1849
XFF4834R_chr_1849
ID pyrB
AC XFF4834R_chr17230
LT XFF4834R_chr17230
OR XFF4834R_chr from 1970257 to 1971204 on strand +
DE probable aspartate carbamoyltransferase, catalytic subunit
IP Aspartate carbamoyltransferase, eukaryotic; Aspartate/ornithine carbamoyltransferase, Asp/Orn-binding region; Aspartate/ornithine carbamoyltransferase, carbamoyl-P binding
CL 1.5.2.2 Pyrimidine biosynthesis GO:0006221
EC
GO InterPro
Biological Process: 'de novo' pyrimidine base biosynthetic process (GO:0006207)
Biological Process: cellular amino acid metabolic process (GO:0006520)
Molecular Function: carboxyl- or carbamoyltransferase activity (GO:0016743)
Molecular Function: aspartate carbamoyltransferase activity (GO:0004070)
Molecular Function: amino acid binding (GO:0016597)

Curated
PM
AN blastp avec pyrB coli : 32% sur la totalite
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100906)
MW 33687.2 Da
SQ 315 aa
 
........10........20........30........40........50
| | | | |
MTTMQLDSDGRLCHLLTLEGLPRTTLLQLLDRAGQIRDAAVGRVGKRSVL
AGTAVCTLFFEPSTRTRSSFHLAAQRLGADVLNFDASTSSTRKGETARDT
LKNLEAMGVRGFVVRHPDDGAVEALAAAAGEGTALINAGDGRSAHPTQGL
LDMLTLRQAKGTDFSKLKVVIVGDVKHSRVARSDLHALRTLGAGEIRVCG
PASLLPEDDMLEGCVVGQDFDAMLEGADALMMLRLQRERMEEGLLPSLEQ
YHTEYGLTRERLARAGRDAAVLHPGPINRGVEITDEVADGAQSCVLRQVA
NGVAVRMAVLETLLG
XFF4834R

YP_364792.1 lcl|pyrB-XCV3061

1

315

S=1497 I=93 E=2.35438e-174

aspartate carbamoyltransferase catalytic subunit

XFF4834R

NP_638094.1 lcl|pyrB-XCC2746

1

315

S=1480 I=92 E=2.70231e-172

aspartate carbamoyltransferase catalytic subunit

XFF4834R

NP_643225.1 lcl|pyrB-XAC2916

1

315

S=1479 I=93 E=3.9659e-172

aspartate carbamoyltransferase catalytic subunit

XFF4834R

lcl|PyrB-XALc_2155

1

315

S=1347 I=84 E=3.87929e-156

putative aspartate carbamoyltransferase, catalytic subunit protein

pubmed

4

310

S=775 I=53 E=3.06731e-85

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

Pubmed 7896697

 

prodomImg

pubmed

3

313

S=768 I=54 E=2.1624e-84

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

Pubmed 19077236

 

prodomImg

pubmed

4

310

S=756 I=52 E=6.36941e-83

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

Pubmed 8234318

 

prodomImg

pubmed

5

310

S=683 I=47 E=4.34526e-74

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

Pubmed 9682487

 

prodomImg

pubmed

14

313

S=666 I=50 E=4.08117e-72

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

Pubmed 17965706

 

prodomImg

pubmed

14

314

S=642 I=51 E=3.44948e-69

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

Pubmed 9171389

 

prodomImg

pubmed

12

314

S=616 I=46 E=5.32096e-66

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

Pubmed 18367281

 

prodomImg

pubmed

15

315

S=616 I=46 E=5.65582e-66

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

Pubmed 18441057

 

prodomImg

pubmed

15

310

S=612 I=45 E=1.41279e-65

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

Pubmed 18391199

 

prodomImg

pubmed

15

315

S=611 I=46 E=2.147e-65

Aspartate carbamoyltransferase EC=2.1.3.2

Pubmed 12446909

 

prodomImg

sp_Pdown

sp|Q3BR21|PYRB_XANC5

1

315

S=1497 I=93 E=6.14145e-173

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

sp_Pdown

sp|Q5H2Z0|PYRB_XANOR

1

315

S=1481 I=93 E=5.28658e-171

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

sp_Pdown

sp|Q2P5W1|PYRB_XANOM

1

315

S=1481 I=93 E=5.28658e-171

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

sp_Pdown

sp|Q8P767|PYRB_XANCP

1

315

S=1480 I=92 E=7.04903e-171

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

sp_Pdown

sp|B0RQN0|PYRB_XANCB

1

315

S=1480 I=92 E=7.04903e-171

Aspartate carbamoyltransferase EC=2.1.3.2 ; Pyrimidine biosynthesis

PD000708

14

96

S=151 I=43 E=9.35152e-11

PD409592

255

315

S=139 I=52 E=2.27375e-09

PDA4M8Y6

99

213

S=138 I=35 E=3.08511e-09

PDA239L5

153

239

S=121 I=37 E=3.16159e-07

PDA7V852

168

206

S=115 I=62 E=1.79234e-06

PDA1F845

210

252

S=111 I=59 E=5.14738e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one p86iM0zv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

96 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr17230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr17230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr17230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr17230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pyrD XFF4834R_chr19340
XFF4834R_chr19330
XFF4834R_chr19330
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19350
XFF4834R_chr19350
ID pyrD
AC XFF4834R_chr19340
LT XFF4834R_chr19340
OR XFF4834R_chr from 2214328 to 2215383 on strand -
DE probable dihydro-orotate oxidase, FMN-linked
IP Dihydroorotate dehydrogenase, class 2; Aldolase-type TIM barrel
CL 1.5.2.2 Pyrimidine biosynthesis GO:0006221
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: UMP biosynthetic process (GO:0006222)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: 'de novo' pyrimidine base biosynthetic process (GO:0006207)
Cellular Component: membrane (GO:0016020)
Molecular Function: dihydroorotate dehydrogenase activity (GO:0004152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: dihydroorotate oxidase activity (GO:0004158)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100906)
MW 37553.7 Da
SQ 351 aa
 
........10........20........30........40........50
| | | | |
MYSLARPFLFSLDAERAHALALRSIDTAYRTGTTALLARRPVPLPTPAFG
LMFPNPVGLGAGLDKNGEHIDALFALGFGFVEIGTVTPRAQEGNPKPRMF
RLPEYQAVINRMGFNNLGVDALVANVQRARRTAGLLGINIGKNKDTPNEE
ATSDYRYCMERVYPLADYITVNISSPNTAGLRELQEEQSLRRLISDLRET
QEALSAQHGKRVPMLVKVAPDLNDRDIDAAARVLADLAVDGVIATNTTVT
RTLVANHPLAAEAGGLSGAPLLGQSTLVLRRLRARLPESIPLIGVGGINS
GADAVAKMAAGASLVQCYSGLVYRGPQLIGECVNAIRRRREAPSGGAVSP
L
XFF4834R

NP_642132.1 lcl|pyrD-XAC1805

1

351

S=1584 I=91 E=0

dihydroorotate dehydrogenase 2

XFF4834R

YP_363566.1 lcl|pyrD-XCV1835

1

351

S=1574 I=91 E=0

dihydroorotate dehydrogenase 2

XFF4834R

NP_637154.1 lcl|pyrD-XCC1788

1

351

S=1498 I=85 E=2.0002e-174

dihydroorotate dehydrogenase 2

XFF4834R

lcl|XALc_1218

1

349

S=1246 I=72 E=7.73502e-144

putative dihydroorotate dehydrogenase (dihydroorotate oxidase) protein

pubmed

1

346

S=1274 I=71 E=1.19826e-145

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

Pubmed 11098140

 

prodomImg

pubmed

1

338

S=851 I=49 E=1.85486e-94

Dihydroorotate dehydrogenase ; Cell membrane FMN Flavoprotein Oxidoreductase Pyrimidine biosynthesis

Pubmed 12517848

 

prodomImg

pubmed

1

338

S=851 I=49 E=2.30661e-94

Dihydroorotate dehydrogenase ; Cell membrane FMN Flavoprotein Oxidoreductase Pyrimidine biosynthesis

Pubmed 12517848

 

prodomImg

pubmed

1

338

S=850 I=49 E=2.34719e-94

Dihydroorotate dehydrogenase ; Cell membrane FMN Flavoprotein Oxidoreductase Pyrimidine biosynthesis

Pubmed 12517848

 

prodomImg

pubmed

1

338

S=847 I=49 E=6.85943e-94

Dihydroorotate dehydrogenase ; Cell membrane FMN Flavoprotein Oxidoreductase Pyrimidine biosynthesis

Pubmed 12517848

 

prodomImg

pubmed

1

338

S=846 I=49 E=7.95533e-94

Dihydroorotate dehydrogenase ; Cell membrane FMN Flavoprotein Oxidoreductase Pyrimidine biosynthesis

Pubmed 12517848

 

prodomImg

pubmed

2

336

S=789 I=50 E=6.64339e-87

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

Pubmed 2992959

 

prodomImg

pubmed

2

336

S=782 I=50 E=4.93498e-86

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

Pubmed 2269282

 

prodomImg

pubmed

1

339

S=650 I=42 E=4.70259e-70

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

Pubmed 17107561

 

prodomImg

pubmed

2

336

S=643 I=45 E=3.31523e-69

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

Pubmed 19077236

 

prodomImg

sp_Pdown

sp|Q8PLJ2|PYRD_XANAC

1

351

S=1584 I=91 E=0

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

sp_Pdown

sp|Q3BUJ7|PYRD_XANC5

1

351

S=1574 I=91 E=0

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

sp_Pdown

sp|Q5H0N0|PYRD_XANOR

1

351

S=1539 I=88 E=5.43099e-178

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

sp_Pdown

sp|Q2P3M0|PYRD_XANOM

1

351

S=1539 I=88 E=5.43099e-178

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

sp_Pdown

sp|B2SLB9|PYRD_XANOP

1

351

S=1534 I=88 E=2.13482e-177

Dihydroorotate dehydrogenase EC=1.3.3.1 ; Cell membrane Flavoprotein FMN Oxidoreductase Pyrimidine biosynthesis

PD001761

50

171

S=358 I=55 E=6.85062e-36

PD637720

133

193

S=246 I=70 E=2.25711e-22

PDA1V3J9

325

351

S=120 I=85 E=4.67698e-07

PD190440

1

45

S=115 I=56 E=1.95413e-06

PDA4W7A3

210

275

S=111 I=41 E=6.45214e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QwDYAJ33)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

47 hits
swiss-prot

Swiss-Prot ncbi-blastp

360 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr19340.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr19340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr19340.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr19340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pyrC XFF4834R_chr23650
XFF4834R_chr23640
XFF4834R_chr23640
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23660
XFF4834R_chr23660
ID pyrC
AC XFF4834R_chr23650
LT XFF4834R_chr23650
OR XFF4834R_chr from 2734931 to 2736280 on strand +
DE probable Dihydroorotase
IP Amidohydrolase 1; Metal-dependent hydrolase, composite domain
CL 1.5.2.2 Pyrimidine biosynthesis GO:0006221
EC
GO InterPro
Molecular Function: hydrolase activity (GO:0016787)
acting on carbon-nitrogen (but not peptide) bonds (GO:0016810)
in cyclic amides (GO:0016812)

Curated
PM
AN nomme au depart allB comme chez coli Bsub ai plutot suivi les xantho
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 49092.3 Da
SQ 449 aa
 
........10........20........30........40........50
| | | | |
MSRTVIVNARLVNEGKEFDADLLIEGGRIAKIDSKIVPAPGDTVVDAAGR
WVLPGMIDDQVHFREPGLTHKGDIATESGAAVAGGLTSFMDMPNTNPPTL
DAPALQAKYDAAAGRAWANYGFYMGASNDNLAHIQSLAPKTAPGIKVFMG
ASTGNMLVDNPETLDAIFRDAPTPIITHCEDTPTIDATMAQYKEKYGDAL
TPEMHPDIRSRQACLKSSQLAVSLARKHNTRLHVLHISTADELSLFEAGP
LVDADGKLRKRITAETCIHFLRFDRSDYARLGNLIKCNPAIKDAEDRLAL
IDALAEDVIDVLATDHAPHTWEEKQKPYAQAPSGLPLVQYALVAALELVH
EGKLPITRIVQKFAHAPAQLFDVEERGFLREGYFADLVMIDNTPFTVKRE
QVLSKCGWSPFEGTTFRSRIAATWVNGQQVWDGEQLVGSAAGQRLTFDR
XFF4834R

NP_642676.1 pyrC-XAC2360

1

449

S=2386 I=100 E=0

dihydroorotase

XFF4834R

YP_364290.1 pyrC-XCV2559

1

449

S=2361 I=98 E=0

dihydroorotase

XFF4834R

NP_637612.1 pyrC-XCC2257

1

449

S=2300 I=96 E=0

dihydroorotase

XFF4834R

XALc_1913 pyrC-XALc_1913

4

449

S=1866 I=79 E=0

putative dihydroorotase domain protein

pubmed

5

442

S=526 I=35 E=7.31824e-55

Putative allantoinase

Pubmed 20081001

 

prodomImg

pubmed

16

440

S=468 I=31 E=7.5338e-48

Dihydroorotase EC=3.5.2.3 ; Hydrolase Metal-binding Pyrimidine biosynthesis Zinc

Pubmed 7929010

 

prodomImg

pubmed

5

436

S=445 I=29 E=4.98839e-45

Allantoinase EC=3.5.2.5 ; Hydrolase Metal-binding Purine metabolism Zinc

Pubmed 11344136

 

prodomImg

pubmed

3

431

S=425 I=30 E=1.22249e-42

Dihydroorotase EC=3.5.2.3 ; Hydrolase Metal-binding Pyrimidine biosynthesis Zinc

Pubmed 15780005

 

prodomImg

pubmed

14

431

S=418 I=29 E=9.40345e-42

Dihydroorotase EC=3.5.2.3 ; Hydrolase Metal-binding Pyrimidine biosynthesis Zinc

Pubmed 18391199

 

prodomImg

sp_Pdown

sp|Q2NHZ6|PYRC_METST

1

416

S=479 I=30 E=2.2204e-49

Dihydroorotase EC=3.5.2.3 ; Hydrolase Metal-binding Pyrimidine biosynthesis Zinc

sp_Pdown

sp|Q8TSA6|PYRC_METAC

6

413

S=471 I=32 E=2.50656e-48

Dihydroorotase EC=3.5.2.3 ; Hydrolase Metal-binding Pyrimidine biosynthesis Zinc

sp_Pdown

sp|A7Z8F5|ALLB_BACA2

1

445

S=470 I=32 E=2.80739e-48

Allantoinase EC=3.5.2.5 ; Hydrolase Metal-binding Purine metabolism Zinc

sp_Pdown

sp|O27199|PYRC_METTH

16

440

S=468 I=31 E=5.12356e-48

Dihydroorotase EC=3.5.2.3 ; Hydrolase Metal-binding Pyrimidine biosynthesis Zinc

sp_Pdown

sp|Q8PVF4|PYRC_METMA

6

413

S=465 I=32 E=1.23597e-47

Dihydroorotase EC=3.5.2.3 ; Hydrolase Metal-binding Pyrimidine biosynthesis Zinc

Iprscan [G3DSA:3.20.20.140]

55

417

-

Iprscan [PTHR11647:SF5]

44

449

-

Iprscan [PTHR11647]

44

449

-

Iprscan IPR006680 [PF01979]

51

391

Amidohydrolase 1

Iprscan IPR002195 [PS00483]

313

324

Dihydroorotase, conserved site

PD001085

60

383

S=341 I=34 E=8.94818e-34

PD684713

384

449

S=143 I=40 E=8.61901e-10

PDA1S5B3

417

449

S=137 I=73 E=4.36262e-09

PDA1S5B2

426

449

S=131 I=100 E=2.15118e-08

PD840262

4

167

S=130 I=26 E=3.15707e-08

PD929867

6

66

S=113 I=41 E=4.16607e-06

PDA7B699

1

71

S=103 I=33 E=6.38121e-05

PD613779

1

99

S=102 I=28 E=7.73047e-05

Iprscan [SSF51556]

55

379

-

Iprscan IPR011059 [SSF51338]

1

429

Metal-dependent hydrolase, composite domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one CR7Hn86m)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

103 hits
swiss-prot

Swiss-Prot ncbi-blastp

259 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr23650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr23650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr23650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr23650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pyrG XFF4834R_chr27950
XFF4834R_chr27940
XFF4834R_chr27940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27960
XFF4834R_chr27960
ID pyrG
AC XFF4834R_chr27950
LT XFF4834R_chr27950
OR XFF4834R_chr from 3221501 to 3223165 on strand -
DE probable CTP synthetase
IP CTP synthase
CL 1.5.2.2 Pyrimidine biosynthesis GO:0006221
EC
GO InterPro
Biological Process: pyrimidine nucleotide biosynthetic process (GO:0006221)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: CTP synthase activity (GO:0003883)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 61490.5 Da
SQ 554 aa
 
........10........20........30........40........50
| | | | |
MTPLIFVTGGVVSSLGKGIAAASLASILEARGLKVTMMKLDPYINVDPGT
MSPFQHGEVYVTDDGAETDLDLGHYERYVRTRLSRKNSVTTGRIYENVIR
KERRGDYLGATVQVIPHITDEIRRCIDEATAGFDVALIEIGGTVGDIESL
PFLEAIRQVRTERGAEKAMFMHLTLVPYIAAAGELKTKPTQHSVKELRSI
GIQPDVLLCRSEQAVPDSERRKIALFTNVSERAVISCPDIDVLYGMPLEL
LRQGLDELVIDQFKLRDKVAAADLSEWAAVVDAVKHPLDEVNIAVVGKYV
DHQDAYKSVAEALRHGGLRQRTKVNLKWLEAQDLEGSDMSALQDIDGILV
PGGFGDRGFEGKVQTSKFAREHKVPYFGICYGMQAAVVDYARHVADLDAA
NSTENDRQSPHPVIGLITEWRTATGEVEKRDEKSDLGGTMRLGLQEQRLK
PGTLAREVYGKDVVAERHRHRYEFNNRYRTQLEDAGLVISGKSMDDTLVE
VVELPRDTHPWFLACQAHPEFLSTPRDGHPLFIGFVRAAREKKAGGKLLK
EARA
XFF4834R

NP_642047.1 pyrG-XAC1716

1

554

S=2839 I=97 E=0

CTP synthetase

XFF4834R

YP_363480.1 pyrG-XCV1749

1

554

S=2836 I=97 E=0

CTP synthetase

XFF4834R

NP_637067.2 pyrG-XCC1697

1

554

S=2796 I=95 E=0

CTP synthetase

XFF4834R

XALc_1149 pyrG-XALc_1149

1

554

S=2672 I=90 E=0

probable ctp synthase (utp--ammonia ligase) protein

pubmed

2

541

S=1776 I=62 E=0

CTP synthase EC=6.3.4.2 ; ATP-binding Glutamine amidotransferase Ligase Nucleotide-binding Pyrimidine biosynthesis

Pubmed 3514618

 

prodomImg

pubmed

1

539

S=1712 I=58 E=0

CTP synthase EC=6.3.4.2 ; ATP-binding Glutamine amidotransferase Ligase Nucleotide-binding Pyrimidine biosynthesis

Pubmed 9711852

 

prodomImg

pubmed

45

545

S=1684 I=61 E=0

Putative uncharacterized protein

Pubmed 8790892

 

prodomImg

pubmed

47

541

S=1600 I=60 E=0

CTP synthetase

Pubmed 12668143

 

prodomImg

pubmed

1

543

S=1508 I=54 E=1.04484e-173

CTP synthase EC=6.3.4.2 ; ATP-binding Glutamine amidotransferase Ligase Nucleotide-binding Pyrimidine biosynthesis

Pubmed 8138139

 

prodomImg

sp_Pdown

sp|Q8PLS3|PYRG_XANAC

1

554

S=2839 I=97 E=0

CTP synthase EC=6.3.4.2 ; ATP-binding Glutamine amidotransferase Ligase Nucleotide-binding Pyrimidine biosynthesis

sp_Pdown

sp|Q3BUT3|PYRG_XANC5

1

554

S=2836 I=97 E=0

CTP synthase EC=6.3.4.2 ; ATP-binding Glutamine amidotransferase Ligase Nucleotide-binding Pyrimidine biosynthesis

sp_Pdown

sp|Q5GYK0|PYRG_XANOR

1

554

S=2818 I=96 E=0

CTP synthase EC=6.3.4.2 ; ATP-binding Glutamine amidotransferase Ligase Nucleotide-binding Pyrimidine biosynthesis

sp_Pdown

sp|B2SUA3|PYRG_XANOP

1

554

S=2818 I=96 E=0

CTP synthase EC=6.3.4.2 ; ATP-binding Glutamine amidotransferase Ligase Nucleotide-binding Pyrimidine biosynthesis

sp_Pdown

sp|Q2P1K5|PYRG_XANOM

1

554

S=2818 I=96 E=0

CTP synthase EC=6.3.4.2 ; ATP-binding Glutamine amidotransferase Ligase Nucleotide-binding Pyrimidine biosynthesis

Iprscan [G3DSA:3.40.50.300]

2

286

-

Iprscan [G3DSA:3.40.50.880]

287

548

-

Iprscan IPR004468 [MF_01227]

2

543

CTP synthase

Iprscan [PTHR11550]

117

542

-

Iprscan IPR017456 [PF06418]

4

269

CTP synthase, N-terminal

Iprscan IPR000991 [PF00117]

303

537

Glutamine amidotransferase class-I, C-terminal

Iprscan IPR004468 [TIGR00337]

1

538

CTP synthase

Iprscan IPR017926 [PS51273]

292

545

Glutamine amidotransferase type 1

Iprscan [seg]

13

28

-

Iprscan [SignalP-NN(euk)]

1

30

-

PD002309

114

229

S=426 I=70 E=4.78809e-44

PD962121

319

421

S=311 I=52 E=3.48784e-30

PDA1F6Q9

51

111

S=254 I=72 E=3.01602e-23

PD888152

428

495

S=219 I=64 E=5.63134e-19

PD002477

499

543

S=162 I=60 E=4.54147e-12

PDA0B0B4

1

49

S=142 I=59 E=1.16256e-09

PDA1F6S3

234

295

S=124 I=47 E=1.52079e-07

PD845300

295

331

S=123 I=57 E=2.27117e-07

PD845301

441

543

S=121 I=29 E=3.83213e-07

PDA0G8M3

33

111

S=103 I=28 E=5.91616e-05

Iprscan [SSF52540]

1

270

-

Iprscan [SSF52317]

288

547

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one G9TVHqan)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

159 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr27950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr27950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr27950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr27950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pyrH XFF4834R_chr30780
XFF4834R_chr30770
XFF4834R_chr30770
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30790
XFF4834R_chr30790
ID pyrH
AC XFF4834R_chr30780
LT XFF4834R_chr30780
OR XFF4834R_chr from 3542204 to 3542926 on strand +
DE probable uridylate kinase
IP Aspartate/glutamate/uridylate kinase
CL 1.5.2.2 Pyrimidine biosynthesis GO:0006221
EC
GO InterPro
Biological Process: pyrimidine nucleotide biosynthetic process (GO:0006221)
Biological Process: cellular amino acid biosynthetic process (GO:0008652)
Biological Process: 'de novo' pyrimidine base biosynthetic process (GO:0006207)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: UMP kinase activity (GO:0033862)
Molecular Function: uridylate kinase activity (GO:0009041)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 25767.4 Da
SQ 240 aa
 
........10........20........30........40........50
| | | | |
MSELSYRRILLKLSGEALMGDGDYGIDPKVINRLAHEVIEAQQAGAQVAL
VIGGGNIFRGAGLAASGMDRVTGDHMGMLATVINALAMQDALETLGAKVR
VMSAIKINDVCEDFIRRRAIRHLEKGRIAIFAAGTGNPFFTTDSGAALRA
IEIGADLLLKATKVDGVYDKDPKKHTDAVRYDSLTYDQVILQGLEVMDTA
AFALARDSDLPLRIFGMSESGVLLRILHGEQIGTLVQGRS
XFF4834R

YP_363207.1 lcl|pyrH-XCV1476

1

240

S=1222 I=99 E=4.10237e-141

uridylate kinase

XFF4834R

NP_641754.1 lcl|pyrH-XAC1419

1

240

S=1216 I=99 E=1.69916e-140

uridylate kinase

XFF4834R

NP_636745.1 lcl|pyrH-XCC1371

1

240

S=1206 I=98 E=2.94051e-139

uridylate kinase

XFF4834R

lcl|pyrH-XALc_2028

1

239

S=1118 I=90 E=1.31784e-128

probable uridylate kinase protein

pubmed

4

237

S=738 I=59 E=6.28178e-81

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 17107561

 

prodomImg

pubmed

4

237

S=724 I=56 E=2.96291e-79

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 17592475

 

prodomImg

pubmed

6

237

S=706 I=60 E=4.11983e-77

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 9973356

 

prodomImg

pubmed

6

236

S=692 I=58 E=2.37468e-75

Uridylate kinase EC=2.7.4.22 ; Allosteric enzyme ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 17210578

 

prodomImg

pubmed

6

236

S=687 I=57 E=9.49859e-75

Uridylate kinase EC=2.7.4.22 ; Allosteric enzyme ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 1447125,7711027

 

prodomImg

pubmed

1

228

S=675 I=53 E=2.43354e-73

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 17916642

 

prodomImg

pubmed

1

236

S=671 I=54 E=6.92818e-73

Uridylate kinase EC=2.7.4.22 ; Allosteric enzyme ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 17210578

 

prodomImg

pubmed

2

236

S=667 I=53 E=2.22849e-72

Uridylate kinase EC=2.7.4.22 ; Allosteric enzyme ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 15637156

 

prodomImg

pubmed

4

237

S=657 I=54 E=4.24473e-71

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 8617268

 

prodomImg

pubmed

3

236

S=649 I=51 E=3.78671e-70

Uridylate kinase EC=2.7.4.22 ; Allosteric enzyme ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

Pubmed 16707693

 

prodomImg

sp_Pdown

sp|Q3BVK6|PYRH_XANC5

1

240

S=1222 I=99 E=1.0338e-139

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

sp_Pdown

sp|P59008|PYRH_XANAC

1

240

S=1216 I=99 E=4.28191e-139

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

sp_Pdown

sp|Q5H1E3|PYRH_XANOR

1

240

S=1214 I=98 E=9.54983e-139

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

sp_Pdown

sp|Q2P4A8|PYRH_XANOM

1

240

S=1214 I=98 E=9.54983e-139

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

sp_Pdown

sp|P59009|PYRH_XANCP

1

240

S=1206 I=98 E=7.4101e-138

Uridylate kinase EC=2.7.4.22 ; ATP-binding Cytoplasm Nucleotide-binding Pyrimidine biosynthesis Transferase

PD421181

19

75

S=175 I=60 E=1.03676e-13

PDA7C3S9

4

75

S=145 I=51 E=4.1007e-10

PDA0T8W4

102

133

S=129 I=75 E=3.37932e-08

PD875552

197

240

S=124 I=50 E=1.55406e-07

PDA707L1

76

131

S=119 I=45 E=6.1622e-07

PDA2A285

76

124

S=111 I=42 E=6.26536e-06

PD000447

133

190

S=103 I=53 E=5.21275e-05

PDA310K8

76

132

S=102 I=42 E=7.78478e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QyOGhuyw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

119 hits
swiss-prot

Swiss-Prot ncbi-blastp

529 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr30780.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr30780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr30780.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr30780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pyrE XFF4834R_chr37900
XFF4834R_chr37890
XFF4834R_chr37890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37910
XFF4834R_chr37910
ID pyrE
AC XFF4834R_chr37900
LT XFF4834R_chr37900
OR XFF4834R_chr from 4381247 to 4381906 on strand +
DE probable orotate phosphoribosyltransferase
IP Phosphoribosyltransferase
CL 1.5.2.2 Pyrimidine biosynthesis GO:0006221
EC
GO InterPro
Biological Process: nucleoside metabolic process (GO:0009116)
Biological Process: pyrimidine nucleotide biosynthetic process (GO:0006221)
Molecular Function: orotate phosphoribosyltransferase activity (GO:0004588)

Curated
PM
AN changement de start de 14 aa en moins
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100907)
MW 22859.6 Da
SQ 219 aa
 
........10........20........30........40........50
| | | | |
MTDHRTRFLQLALDADALRFGEFTLKSGRLSPYFFNAGRFDSGAKTAQLA
QCYADAIDAAGLDFDLLFGPAYKGIPLATALACTYAGRGRDLPLAFNRKE
AKDHGEGGTLIGAPLAGRKVLIIDDVITAGTATREALAIIRAAGGTPSGI
VVALDRQEIASDQDRRSAAQAVAAEAGIPVIAVANLGDLLAFAAGNADLV
GFQEPLLAYRGRYGTDTTG
XFF4834R

YP_365747.1 lcl|pyrE-XCV4016

1

219

S=1033 I=94 E=2.27559e-118

orotate phosphoribosyltransferase

XFF4834R

NP_644204.1 lcl|pyrE-XAC3903

1

219

S=1026 I=93 E=1.7352e-117

orotate phosphoribosyltransferase

XFF4834R

NP_639187.1 lcl|pyrE-XCC3847

1

219

S=1010 I=91 E=1.41754e-115

orotate phosphoribosyltransferase

XFF4834R

lcl|pyrE-XALc_0377

1

216

S=842 I=80 E=3.57458e-95

probable orotate phosphoribosyltransferase protein

pubmed

1

214

S=523 I=53 E=5.14762e-55

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

Pubmed 8824606

 

prodomImg

pubmed

1

214

S=519 I=48 E=1.75996e-54

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Pyrimidine biosynthesis

Pubmed 10509020

 

prodomImg

pubmed

1

215

S=515 I=50 E=5.96506e-54

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

Pubmed 11889481

 

prodomImg

pubmed

1

215

S=512 I=49 E=1.07919e-53

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

Pubmed 8487307

 

prodomImg

pubmed

1

215

S=496 I=48 E=1.07739e-51

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

Pubmed 6349999,6207018

 

prodomImg

pubmed

1

195

S=489 I=50 E=6.96119e-51

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Pyrimidine biosynthesis

Pubmed 7597846

 

prodomImg

pubmed

1

215

S=486 I=43 E=1.59368e-50

Orotate phosphoribosyl transferase

Pubmed 14981288

 

prodomImg

pubmed

1

195

S=485 I=48 E=2.46449e-50

Orotate phosphoribosyltransferase 1 EC=2.4.2.10 ; Glycosyltransferase Pyrimidine biosynthesis

Pubmed 2651891

 

prodomImg

pubmed

1

215

S=478 I=45 E=1.44673e-49

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

Pubmed 10675023

 

prodomImg

pubmed

1

214

S=474 I=43 E=4.6131e-49

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase

Pubmed 9862479

 

prodomImg

sp_Pdown

sp|Q3BNB6|PYRE_XANC5

1

219

S=1033 I=94 E=5.64396e-117

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

sp_Pdown

sp|Q8PFS5|PYRE_XANAC

1

219

S=1026 I=93 E=4.30367e-116

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

sp_Pdown

sp|Q8P469|PYRE_XANCP

1

219

S=1010 I=91 E=3.5158e-114

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

sp_Pdown

sp|B0RXL2|PYRE_XANCB

1

219

S=1010 I=91 E=3.5158e-114

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

sp_Pdown

sp|Q4UPQ3|PYRE_XANC8

1

219

S=1010 I=91 E=3.5158e-114

Orotate phosphoribosyltransferase EC=2.4.2.10 ; Glycosyltransferase Magnesium Pyrimidine biosynthesis

Iprscan [G3DSA:3.40.50.2020]

1

215

-

Iprscan IPR000836 [PF00156]

45

153

Phosphoribosyltransferase

Iprscan IPR004467 [TIGR00336]

10

189

Orotate phosphoribosyl transferase

Iprscan [seg]

168

176

-

PDA1F8D3

42

117

S=222 I=60 E=2.22558e-19

PD868993

190

219

S=145 I=97 E=3.75972e-10

PDA1F8G2

8

41

S=131 I=65 E=1.93489e-08

Iprscan [SSF53271]

1

215

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one PfDH5Y1H)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

120 hits
swiss-prot

Swiss-Prot ncbi-blastp

342 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr37900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr37900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr37900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr37900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr42550972_4531916_f3_XFF4834R-XFF4834R_chr39340 XFF4834R_chr39340
XFF4834R_chr39330
XFF4834R_chr39330
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr39350
XFF4834R_chr39350
ID XFF4834R_chr42550972_4531916_f3_XFF4834R-XFF4834R_chr39340
AC XFF4834R_chr39340
LT XFF4834R_chr39340
OR XFF4834R_chr from 4530972 to 4531916 on strand +
DE putative 2-dehydropantoate 2-reductase
IP Ketopantoate reductase ApbA/PanE; Dehydrogenase, multihelical; Ketopantoate reductase ApbA/PanE, C-terminal; NAD(P)-binding domain
CL 1.5.2.2 Pyrimidine biosynthesis GO:0006221
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: pantothenate biosynthetic process (GO:0015940)
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: NADP or NADPH binding (GO:0050661)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: coenzyme binding (GO:0050662)
Molecular Function: binding (GO:0005488)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100412)
MW 33037.5 Da
SQ 314 aa
 
........10........20........30........40........50
| | | | |
MAVRILILGAGGTGGYFGGRLAQAGVDVTFLVREARAAQLQADGLRIRSP
LGDADLQVAHVTAQDLPALVAQQPFDLVILSCKAYDLDSAIDAIAPAVGE
HTTVLPILNGLRHYAALDARFGAARVLGGLCFISATKGEHGEILHLGKPA
AITFGERSGDAHSARVQAFAAACAQADITHVASEKIAQEQWIKYSFLTAL
AAATCLMRAPVGAIVATDDGRALINGLYNECLWAADAAGQSIPEPARAKA
LQTLLQVDSPLKASMLRDLEAGQDVEAAQIVGDMLARVRETGRNAPLLMA
ANVHLQAYQVLRHR
Show or not Domain decomposition
 
XFF4834R

NP_644367.1 lcl|apbA-XAC4068

3

314

S=1439 I=90 E=2.63342e-167

2-dehydropantoate 2-reductase

XFF4834R

YP_365885.1 lcl|XCV4154

1

313

S=1397 I=88 E=3.14937e-162

2-dehydropantoate 2-reductase

XFF4834R

NP_639319.1 lcl|apbA-XCC3980

3

313

S=1341 I=86 E=2.17096e-155

2-dehydropantoate 2-reductase

XFF4834R

lcl|panE-XALc_3010

3

309

S=925 I=60 E=5.15602e-105

probable 2-dehydropantoate 2-reductase (ketopantoate reductase) protein

pubmed

21

307

S=126 I=25 E=1.30417e-06

2-dehydropantoate 2-reductase EC=1.1.1.169 ; NADP Oxidoreductase Pantothenate biosynthesis

Pubmed 17372221

 

prodomImg

sp_Pdown

sp|O31717|YKPB_BACSU

20

309

S=410 I=34 E=3.02653e-41

Uncharacterized oxidoreductase ykpB EC=1.1.1.- ; NADP

sp_Pdown

sp|Q8YX96|PANE_ANASP

20

296

S=167 I=25 E=9.0178e-12

Putative 2-dehydropantoate 2-reductase EC=1.1.1.169 ; Cytoplasm NADP Oxidoreductase Pantothenate biosynthesis

sp_Pdown

sp|Q987N5|PANE_RHILO

20

293

S=140 I=27 E=1.76025e-08

Putative 2-dehydropantoate 2-reductase EC=1.1.1.169 ; Cytoplasm NADP Oxidoreductase Pantothenate biosynthesis

sp_Pdown

sp|Q9HRF0|PANE_HALSA

39

290

S=110 I=26 E=8.43444e-05

Putative 2-dehydropantoate 2-reductase EC=1.1.1.169 ; Cytoplasm NADP Oxidoreductase Pantothenate biosynthesis

Iprscan IPR016040 [G3DSA:3.40.50.720]

3

147

NAD(P)-binding domain

Iprscan IPR013328 [G3DSA:1.10.1040.10]

185

309

Dehydrogenase, multihelical

Iprscan IPR013332 [PF02558]

5

159

Ketopantoate reductase ApbA/PanE, N-terminal

Iprscan IPR013752 [PF08546]

185

309

Ketopantoate reductase ApbA/PanE, C-terminal

Iprscan IPR003710 [TIGR00745]

4

312

Ketopantoate reductase ApbA/PanE

Iprscan [seg]

9

19

-

Iprscan [seg]

164

176

-

PDA1J0P3

194

268

S=195 I=56 E=4.15622e-16

PDA203T1

41

73

S=149 I=94 E=1.46531e-10

PDA4Q0J5

194

313

S=133 I=28 E=1.30611e-08

PDA7I0R8

44

113

S=106 I=40 E=2.63996e-05

PDA1F7W5

116

193

S=104 I=35 E=4.15428e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0ovrUotv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr39340.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr39340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr39340.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTuW_uH/XFF4834R_chr39340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pyrF XFF4834R_chr41420
XFF4834R_chr41410
XFF4834R_chr41410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed