Xanthomonas fuscans subsp. fuscans

7 hits

  1. XFF4834R_chr03100metEXFF4834R_chr03100putative 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase
  2. XFF4834R_chr16000XFF4834R_chr17220217_1848248_f3_XFF4834R-XFF4834R_chr16000XFF4834R_chr16000putative homoserine O-acetyltransferase
  3. XFF4834R_chr16010metB1XFF4834R_chr16010cystathionine gamma-synthase
  4. XFF4834R_chr19830XFF4834R_chr21300627_2277325_r3_XFF4834R-XFF4834R_chr19830XFF4834R_chr19830Putative enolase-phosphatase
  5. XFF4834R_chr23260XFF4834R_chr25460880_2695028_r2_XFF4834R-XFF4834R_chr23260XFF4834R_chr23260putative methionine aminotransferase, PLP-dependent
  6. XFF4834R_chr23360XFF4834R_chr25530530_2703732_f1_XFF4834R-XFF4834R_chr23360XFF4834R_chr23360probable homoserine O-acetyltransferase
  7. XFF4834R_chr31050mmuMXFF4834R_chr31050probable homocysteine S-methyltransferase

metE XFF4834R_chr03100
XFF4834R_chr03090
XFF4834R_chr03090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03110
XFF4834R_chr03110
ID metE
AC XFF4834R_chr03100
LT XFF4834R_chr03100
OR XFF4834R_chr from 362130 to 363068 on strand +
DE putative 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase
IP Methionine synthase, vitamin-B12 independent
CL 1.5.1.9 Methionine GO:0009086
EC
GO InterPro
Biological Process: methionine biosynthetic process (GO:0009086)
Molecular Function: 5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity (GO:0003871)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 34904.3 Da
SQ 312 aa
 
........10........20........30........40........50
| | | | |
MQDAELIEGKQDALRLSLQEQQHAGIDIVSDGEQTRQHFVTTFIEHLSGV
DFEKRETVRIRDRYDASVPTVVGAVSRPRSVFVDDAKFLRQQTGQPIKWA
LPGPMTMIDTLFDAHYKSREKLAWEFAKILNQEARELEAAGVDIIQFDEP
AFNVFFDEVNDWGVATLERAVEGLKCETAVHICYGYGIKANTDWKQTLGS
EWRQYEESFPKLQTSSLDIISLECHNSHVPIDLIELVRGKKVMVGAIDVA
STTIETPQEVAETLRKALRFVDADKLYPSTNCGMAPLARHVARGKLSALS
AGAQIVRGELSA
XFF4834R

NP_640692.1 lcl|metE-XAC0336

1

312

S=1653 I=99 E=0

5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase

XFF4834R

YP_362076.1 lcl|metE-XCV0345

1

312

S=1626 I=97 E=0

5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase

XFF4834R

NP_635713.1 lcl|metE-XCC0318

1

312

S=1588 I=94 E=0

5-methyltetrahydropteroyltriglutamate-- homocysteine methyltransferase

XFF4834R

lcl|metE-XALc_0169

21

309

S=238 I=29 E=7.70531e-22

probable5-methyltetrahydropteroyltriglutamate--homocysteine s-methyltransferase protein

pubmed

1

311

S=1423 I=83 E=7.72805e-164

MetE

Pubmed 11479715

 

prodomImg

pubmed

3

311

S=323 I=32 E=1.82027e-30

2-hydroxypropyl-CoM lyase EC=4.4.1.23 ; Metal-binding Plasmid Zinc

Pubmed 7704278,9405410

 

prodomImg

pubmed

1

312

S=313 I=31 E=2.40404e-29

Epoxyalkane: coenzyme M transferase Methionine synthase (B12-independent) EC=2.1.1.14 ; Methyltransferase Plasmid

Pubmed 15599705

 

prodomImg

pubmed

1

310

S=288 I=31 E=3.25373e-26

Epoxyalkane:coenzyme M transferase

Pubmed 12949106

 

prodomImg

pubmed

9

307

S=266 I=27 E=1.28802e-23

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Repeat Zinc

Pubmed 1339288,1379743

 

prodomImg

pubmed

14

307

S=264 I=28 E=2.60994e-23

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Zinc

Pubmed 16088217

 

prodomImg

pubmed

11

310

S=250 I=27 E=1.29713e-21

5-methyltetrahydropteroyltriglutamate-homocysteine methyltransferase-like protein ; Amino-acid biosynthesis Metal-binding Methionine Zinc

Pubmed 10858335

 

prodomImg

pubmed

1

284

S=242 I=25 E=9.46908e-21

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Repeat Zinc

Pubmed 19077236

 

prodomImg

pubmed

14

311

S=228 I=26 E=5.50578e-19

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Repeat Zinc

Pubmed 16645985

 

prodomImg

pubmed

21

284

S=226 I=27 E=9.8745e-19

5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase EC=2.1.1.14 ; Amino-acid biosynthesis Metal-binding Methionine Repeat Zinc

Pubmed 17038625

 

prodomImg

sp_Pdown

sp|Q975N4|METE_SULTO

1

311

S=371 I=30 E=1.73941e-36

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

sp_Pdown

sp|Q4JAI4|METE_SULAC

5

311

S=371 I=30 E=1.83283e-36

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

sp_Pdown

sp|Q980A9|METE_SULSO

1

310

S=349 I=29 E=7.06813e-34

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

sp_Pdown

sp|Q9YA91|METE_AERPE

11

309

S=344 I=31 E=3.13904e-33

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

sp_Pdown

sp|Q5JH51|METE_PYRKO

1

311

S=342 I=29 E=5.02653e-33

Probable methylcobalamin:homocysteine methyltransferase EC=2.1.1.- ; Amino-acid biosynthesis Metal-binding Methionine Zinc

Iprscan [G3DSA:3.20.20.210]

2

312

-

Iprscan IPR002629 [PF01717]

18

184

Methionine synthase, vitamin-B12 independent

PD004692

99

291

S=553 I=55 E=1.50033e-59

PD712689

1

98

S=397 I=80 E=1.1875e-40

PDA8S7R8

240

310

S=134 I=41 E=8.67105e-09

PD191524

69

184

S=130 I=33 E=2.99058e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LYhQPqDU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

46 hits
swiss-prot

Swiss-Prot ncbi-blastp

275 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr03100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr03100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr03100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr03100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr17220217_1848248_f3_XFF4834R-XFF4834R_chr16000 XFF4834R_chr16000
XFF4834R_chr15990
XFF4834R_chr15990
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16010
XFF4834R_chr16010
ID XFF4834R_chr17220217_1848248_f3_XFF4834R-XFF4834R_chr16000
AC XFF4834R_chr16000
LT XFF4834R_chr16000
OR XFF4834R_chr from 1847217 to 1848248 on strand +
DE putative homoserine O-acetyltransferase
IP Alpha/beta hydrolase fold-1
CL 1.5.1.9 Methionine GO:0009086
EC
GO InterPro
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: O-acetyltransferase activity (GO:0016413)

Curated
PM
AN Homoserine acetyltransferase (homoserine transacetylase) catalyses the first step unique to methionine biosynthesis, converting L-homoserine to O-acetyl-L-homoserine using acetyl-CoA as an acetyl group donor [1]. This enzyme regulates homoserine in a number of biosynthetic pathways, making it vital to cell growth and viability. The biosynthesis of methionine in particular has been shown to be susceptible to small-molecule inhibition in fungi and is consequently a good candidate for antifungal agents [2].
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 36607.2 Da
SQ 343 aa
 
........10........20........30........40........50
| | | | |
MSLVNTASPSTNDFVDTPASSDDGITAVRGELVIALPMRHAGMRELRLRY
ELIGAANAPVVFVAGGISAHRHLAASDLFPEKGWVDGLVGSGRALDPASR
RLLAFDFLGADGILDAPIDTADQADAIAALLDALGIGRLHGFVGYSYGAL
VGLQFAIRHAARVGTLVAVSGAHRAHPYAAAWRALQRRAVALGQLQCAEQ
HGLALARQFAMLSYRTPEEFSERFDAPPEVINGRVRVAAEDYLDAAGAQY
VARTPVNAYLRLSESIDLHRIDPAQVRLPTVVVAVEGDRLVPLADMVSLV
EGLGPRGSLRVLRSPYGHDAFLKEIDRIDAILTTALRSTGETP
XFF4834R

XFF4834R_chr23360 lcl|XFF4834R_chr25530530_2703732_f1_XFF4834R-XFF4834R_chr23360

138

267

S=112 I=27 E=5.46632e-07

XFF4834R

NP_643349.1 lcl|metA-XAC3040

1

343

S=1553 I=93 E=0

homoserine O-acetyltransferase

XFF4834R

YP_364908.1 lcl|XCV3177

1

342

S=1533 I=92 E=1.10403e-178

homoserine O-acetyltransferase

XFF4834R

NP_638205.1 lcl|metA-XCC2857

1

342

S=1362 I=83 E=6.42947e-158

homoserine O-acetyltransferase

XFF4834R

lcl|XALc_2186

1

340

S=1207 I=74 E=3.52849e-139

putative homoserine o-acetyltransferase protein

XFF4834R

lcl|metX-XALc_1289

138

336

S=144 I=28 E=2.21593e-10

probable homoserine o-acetyltransferase (homoserine transacetylase) protein

XFF4834R

NP_637584.1 lcl|metX-XCC2228

138

328

S=130 I=27 E=1.09175e-08

homoserine O-acetyltransferase

XFF4834R

YP_364262.1 lcl|metX-XCV2531

138

267

S=116 I=28 E=6.80656e-07

homoserine O-acetyltransferase

XFF4834R

NP_642649.1 lcl|metX-XAC2332

138

267

S=112 I=27 E=2.04187e-06

homoserine O-acetyltransferase

pubmed

200

324

S=173 I=35 E=3.11541e-12

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 18192381

 

prodomImg

pubmed

138

268

S=148 I=30 E=3.00111e-09

Putative serine O-acetyltransferase

Pubmed 11021945

 

prodomImg

pubmed

197

332

S=141 I=30 E=2.22935e-08

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 9666465

 

prodomImg

pubmed

138

341

S=138 I=26 E=4.28712e-08

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 9209059

 

prodomImg

pubmed

238

342

S=134 I=25 E=1.44042e-07

Homoserine O-acetyltransferase

Pubmed 15691752

 

prodomImg

pubmed

238

342

S=134 I=25 E=1.44042e-07

Homoserine O-acetyltransferase

Pubmed 15691752

 

prodomImg

pubmed

238

342

S=134 I=25 E=1.44042e-07

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase

Pubmed 15691752

 

prodomImg

pubmed

238

339

S=134 I=26 E=1.68518e-07

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Methionine

Pubmed 3552887

 

prodomImg

pubmed

138

336

S=131 I=25 E=3.21254e-07

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 18367281

 

prodomImg

pubmed

138

268

S=126 I=30 E=1.38989e-06

L-homoserine-O-acetyltransferase

Pubmed 19129631

 

prodomImg

sp_Pdown

sp|Q9RA51|METX_THET2

143

336

S=246 I=35 E=2.85689e-21

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

sp_Pdown

sp|Q5SK89|METX_THET8

143

336

S=246 I=35 E=3.01032e-21

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Iprscan [G3DSA:3.40.50.1820]

34

336

-

Iprscan IPR008220 [PIRSF000443]

1

343

Homoserine acetyltransferase

Iprscan IPR000073 [PF00561]

100

334

Alpha/beta hydrolase fold-1

Iprscan [seg]

115

136

-

PDA1L2S8

188

273

S=430 I=97 E=1.39315e-44

PD692155

4

114

S=400 I=71 E=5.13909e-41

PDA8K386

166

339

S=165 I=30 E=1.46714e-12

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one DTm7imF0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

15 hits
swiss-prot

Swiss-Prot ncbi-blastp

67 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr16000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr16000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr16000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr16000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
metB1 XFF4834R_chr16010
XFF4834R_chr16000
XFF4834R_chr16000
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16020
XFF4834R_chr16020
ID metB1
AC XFF4834R_chr16010
LT XFF4834R_chr16010
OR XFF4834R_chr from 1848245 to 1849462 on strand +
DE cystathionine gamma-synthase
IP Cys/Met metabolism, pyridoxal phosphate-dependent enzyme; O-succinylhomoserine (thiol)-lyase; Pyridoxal phosphate-dependent transferase, major region, subdomain 1; Pyridoxal phosphate-dependent transferase, major region, subdomain 2
CL 1.5.1.9 Methionine GO:0009086
EC
GO InterPro
Biological Process: cellular amino acid metabolic process (GO:0006520)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: pyridoxal phosphate binding (GO:0030170)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 42527.7 Da
SQ 405 aa
 
........10........20........30........40........50
| | | | |
MSFRDPTDAPCTAATAAVRAGIDRDTAYGAVTPPIVLSSNFSFDGFGNKR
QYDYTRSGNPTRDLLGEALAELEGGAGGVITSTGMGAINLVLNAVLQPGD
TLVVPHDAYGGSWRLFNALAKKGHFALITADLTDPRSLADALAQSPKLVL
IETPSNPLLRITDLRFVIEAAKKVGALTVVDNTFLSPALQKPLDFGADLV
LHSTTKYINGHSDVVGGAVVARDAQLHQQLVWWANALGLTGSPFDAFLTL
RGLRTLDARLRVHQENADAIAALLDGHAAVNQVYFPGLASHPGHALAARQ
QKGFGAMMSFELEGGEAAVRAFVDGLRYFTLAESLGGVESLIAHPASMTH
AAMTAEARAAAGISDGLLRLSIGIESAEDLLADLRAGLARAEATLTNASR
KQVDA
XFF4834R

XFF4834R_chr34960 lcl|XFF4834R_chr_4058666_4059853_r3_XFF4834R-XFF4834R_chr34960

18

375

S=741 I=43 E=3.62632e-83

XFF4834R

NP_643348.1 lcl|metB-XAC3039

1

405

S=1717 I=84 E=0

cystathionine gamma-synthase

XFF4834R

YP_364907.1 lcl|metB-XCV3176

1

405

S=1702 I=83 E=0

cystathionine gamma-synthase

XFF4834R

NP_638204.1 lcl|metB-XCC2856

1

405

S=1651 I=80 E=0

cystathionine gamma-synthase

XFF4834R

lcl|metC-XALc_2185

18

405

S=1502 I=74 E=8.48916e-175

putative cystathionine beta-lyases/cystathionine gamma-synthases protein

XFF4834R

lcl|XALc_2712

18

375

S=764 I=45 E=2.513e-85

probable cys/met metabolism plp-dependent enzyme protein

XFF4834R

NP_643909.1 lcl|metB-XAC3602

18

375

S=746 I=44 E=3.52485e-83

cystathionine gamma-lyase-like protein

XFF4834R

NP_635990.1 lcl|metB-XCC0598

18

375

S=742 I=43 E=1.0301e-82

cystathionine gamma-lyase-like protein

XFF4834R

YP_365456.1 lcl|XCV3725

18

375

S=726 I=43 E=9.59098e-81

Cys/Met metabolism PLP-dependent enzyme

XFF4834R

NP_638415.1 lcl|metB-XCC3068

18

213

S=241 I=31 E=5.70156e-22

homocysteine synthase

XFF4834R

NP_638415.1 lcl|metB-XCC3068

242

375

S=237 I=43 E=1.77109e-21

homocysteine synthase

pubmed

18

375

S=1001 I=53 E=1.69851e-112

Cystathionine gamma-synthase EC=2.5.1.48 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate Transferase

Pubmed 6361020,8346018

 

prodomImg

pubmed

18

375

S=998 I=54 E=3.47185e-112

Cystathionine-gamma-synthase ; Pyridoxal phosphate

Pubmed 16885444

 

prodomImg

pubmed

18

375

S=761 I=45 E=1.92274e-83

Probable cystathionine gamma-synthase ; Pyridoxal phosphate

Pubmed 12375103

 

prodomImg

pubmed

18

375

S=743 I=43 E=3.10065e-81

Cystathionine gamma-synthase EC=4.2.99.9 ; Lyase Pyridoxal phosphate

Pubmed 11589581

 

prodomImg

pubmed

18

376

S=740 I=42 E=6.22836e-81

Cystathionine beta-lyase EC=4.4.1.8 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate

Pubmed 10618201,10620674

 

prodomImg

pubmed

18

376

S=734 I=42 E=3.4099e-80

Cystathionine beta-lyase EC=4.4.1.8 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate

Pubmed 10618201

 

prodomImg

pubmed

18

375

S=732 I=42 E=5.85471e-80

Cystathionine gamma-lyase EC=4.4.1.1 ; Amino-acid biosynthesis Cysteine Cytoplasm Pyridoxal phosphate

Pubmed 17259634

 

prodomImg

pubmed

18

376

S=727 I=42 E=2.62292e-79

Cystathionine beta-lyase EC=4.4.1.8 ; Amino-acid biosynthesis Cytoplasm Methionine Pyridoxal phosphate

Pubmed 17088354

 

prodomImg

pubmed

18

375

S=719 I=41 E=2.76147e-78

Cystathionine gamma-synthase EC=2.5.1.48 ; Pyridoxal phosphate Transferase

Pubmed 17981822

 

prodomImg

pubmed

18

375

S=702 I=40 E=2.4189e-76

Cystathionine gamma-lyase-like protein ; Pyridoxal phosphate

Pubmed 9150229,10094698

 

prodomImg

Iprscan [coil]

374

402

-

Iprscan IPR015421 [G3DSA:3.40.640.10]

9

256

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan IPR015422 [G3DSA:3.90.1150.10]

257

394

Pyridoxal phosphate-dependent transferase, major region, subdomain 2

Iprscan IPR000277 [PIRSF001434]

14

392

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

Iprscan IPR000277 [PF01053]

14

389

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

Iprscan IPR011821 [TIGR02080]

12

391

O-succinylhomoserine (thiol)-lyase

Iprscan IPR000277 [PS00868]

198

212

Cys/Met metabolism, pyridoxal phosphate-dependent enzyme

Iprscan [seg]

5

17

-

Iprscan [seg]

64

78

-

Iprscan [seg]

214

221

-

Iprscan [seg]

351

361

-

Iprscan [seg]

377

393

-

PD590311

287

347

S=157 I=57 E=1.42347e-11

PD596743

192

373

S=125 I=29 E=1.28898e-07

PD945095

18

47

S=122 I=73 E=2.50046e-07

PDA328A5

95

127

S=117 I=64 E=9.49194e-07

PD585777

242

283

S=117 I=55 E=1.15996e-06

PDA338C0

190

233

S=108 I=48 E=1.27566e-05

PDA1F7T5

189

213

S=107 I=72 E=1.68617e-05

PDA1B6M3

140

188

S=103 I=49 E=5.81548e-05

PD531643

187

212

S=101 I=65 E=8.09976e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QzhOo1s6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

115 hits
swiss-prot

Swiss-Prot ncbi-blastp

49 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr16010.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr16010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr16010.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr16010.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr21300627_2277325_r3_XFF4834R-XFF4834R_chr19830 XFF4834R_chr19830
XFF4834R_chr19820
XFF4834R_chr19820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19840
XFF4834R_chr19840
ID XFF4834R_chr21300627_2277325_r3_XFF4834R-XFF4834R_chr19830
AC XFF4834R_chr19830
LT XFF4834R_chr19830
OR XFF4834R_chr from 2276627 to 2277325 on strand -
DE Putative enolase-phosphatase
IP HAD-superfamily hydrolase, subfamily IA, variant 1; 2,3-diketo-5-methylthio-1-phosphopentane phosphatase
CL 1.5.1.9 Methionine GO:0009086
EC
GO InterPro
Biological Process: L-methionine salvage from methylthioadenosine (GO:0019509)
Biological Process: metabolic process (GO:0008152)
Molecular Function: phosphoglycolate phosphatase activity (GO:0008967)
Molecular Function: metal ion binding (GO:0046872)
Molecular Function: acireductone synthase activity (GO:0043874)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100827)
MW 25891.9 Da
SQ 232 aa
 
........10........20........30........40........50
| | | | |
MTRPQAILTDIEGTTSSISFVKDVLFPYARRAMPAYVREHGNHPQVRHWL
NQVADEIGEDVPDEVLITTLQTWIDEDRKHTALKALQGLIWGEGYKTADF
TAHIYADAAIQLKAWHAAGIPLYVYSSGSVPAQKLFFAHSDAGDLSGLIT
DWFDTEVGLKRESASYRRIAERIGVPGPEILFLSDVIEELDAAKRAGMRT
ALLDRLDDYPTPRSADEVGSHQRVESFSQLVL
XFF4834R

NP_642164.1 XAC1838-XAC1838

1

232

S=1203 I=99 E=6.5753e-139

enolase-phosphatase

XFF4834R

YP_363615.1 XCV1884

1

232

S=1193 I=98 E=1.08936e-137

putative haloacid dehalogenase-like hydrolase

XFF4834R

NP_637183.1 XCC1818

1

232

S=1148 I=93 E=2.78163e-132

enolase-phosphatase

XFF4834R

XALc_1320 XALc_1320

1

230

S=803 I=66 E=1.83004e-90

hypothetical haloacid dehalogenase-like hydrolase protein

pubmed

5

210

S=522 I=54 E=9.429e-55

Enolase-phosphatase E1 EC=3.1.3.77 ; Amino-acid biosynthesis Hydrolase Magnesium Metal-binding Methionine

Pubmed 8227040,15102328

 

prodomImg

pubmed

5

230

S=505 I=47 E=9.25054e-53

Enolase-phosphatase E1 EC=3.1.3.77 ; Amino-acid biosynthesis Hydrolase Magnesium Metal-binding Methionine

Pubmed 16563686

 

prodomImg

pubmed

5

205

S=465 I=50 E=6.73038e-48

Enolase-phosphatase E1 EC=3.1.3.77 ; Amino-acid biosynthesis Hydrolase Magnesium Metal-binding Methionine

Pubmed 17965706

 

prodomImg

pubmed

7

212

S=448 I=46 E=7.92972e-46

Enolase-phosphatase E1 EC=3.1.3.77 ; Amino-acid biosynthesis Hydrolase Magnesium Metal-binding Methionine

Pubmed 10518757

 

prodomImg

pubmed

7

230

S=388 I=40 E=1.69798e-38

Probable bifunctional methylthioribulose-1-phosphate dehydratase/enolase-phosphatase E1 EC=4.2.1.109 EC=3.1.3.77 ; Alternative splicing Amino-acid biosynthesis Hy

Pubmed 9501997

 

prodomImg

sp_Pdown

acc=Q8PLG2

1

232

S=1203 I=99 E=1.79967e-137

Enolase-phosphatase E1 EC=3.1.3.77 ; Amino-acid biosynthesis Hydrolase Magnesium Metal-binding Methionine

sp_Pdown

acc=Q3BUE8

1

232

S=1193 I=98 E=2.98158e-136

Enolase-phosphatase E1 EC=3.1.3.77 ; Amino-acid biosynthesis Hydrolase Magnesium Metal-binding Methionine

sp_Pdown

acc=B0RSM3

1

232

S=1152 I=93 E=2.60517e-131

Enolase-phosphatase E1 EC=3.1.3.77 ; Amino-acid biosynthesis Hydrolase Magnesium Metal-binding Methionine

sp_Pdown

acc=Q8P9N5

1

232

S=1148 I=93 E=7.61335e-131

Enolase-phosphatase E1 EC=3.1.3.77 ; Amino-acid biosynthesis Hydrolase Magnesium Metal-binding Methionine

sp_Pdown

acc=Q4UU49

1

232

S=1148 I=93 E=7.61335e-131

Enolase-phosphatase E1 EC=3.1.3.77 ; Amino-acid biosynthesis Hydrolase Magnesium Metal-binding Methionine

Iprscan [G3DSA:3.40.50.1000]

104

230

-

Iprscan [MF_01681]

3

230

-

Iprscan IPR010041 [PTHR20371]

14

232

2,3-diketo-5-methylthio-1-phosphopentane phosphatase

Iprscan IPR010041 [TIGR01691]

5

230

2,3-diketo-5-methylthio-1-phosphopentane phosphatase

Iprscan IPR006439 [TIGR01549]

6

197

HAD-superfamily hydrolase, subfamily IA, variant 1

PD780521

33

119

S=187 I=43 E=3.23231e-15

PDA7O3M2

203

232

S=154 I=100 E=3.00448e-11

PDA1Q320

120

143

S=124 I=100 E=1.33099e-07

PDA1S9N5

116

143

S=123 I=82 E=1.66964e-07

PDA2B6P1

209

232

S=118 I=92 E=7.8133e-07

PDA350V7

209

232

S=115 I=88 E=1.96881e-06

PD017181

5

30

S=114 I=85 E=2.67136e-06

PDA4H9J5

120

150

S=112 I=65 E=3.8527e-06

PD415020

120

158

S=110 I=57 E=6.79028e-06

PDA1G928

160

205

S=110 I=54 E=6.84975e-06

Iprscan [SSF56784]

1

230

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one tEhnTp1W)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

168 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr19830.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr19830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr19830.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr19830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr25460880_2695028_r2_XFF4834R-XFF4834R_chr23260 XFF4834R_chr23260
XFF4834R_chr23250
XFF4834R_chr23250
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23270
XFF4834R_chr23270
ID XFF4834R_chr25460880_2695028_r2_XFF4834R-XFF4834R_chr23260
AC XFF4834R_chr23260
LT XFF4834R_chr23260
OR XFF4834R_chr from 2693880 to 2695028 on strand -
DE putative methionine aminotransferase, PLP-dependent
IP Aminotransferases, class-I, pyridoxal-phosphate-binding site
CL 1.5.1.9 Methionine GO:0009086
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: catalytic activity (GO:0003824)
transferring nitrogenous groups (GO:0016769)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 42163.8 Da
SQ 382 aa
 
........10........20........30........40........50
| | | | |
MPLTTKLPKVGTTIFTVMSQLAAEHGAVNLGQGFPDFAVPQRLVDELSKA
MAAGHNQYPPMAGVATLRQAIAGKAQRCYGAQVDADTEITVTSGATEAIF
NAIHAVVRAGEEVIVLDPAYDCYEPAIDLAGARAVHVALHPQTFAVDWDA
LRAAITPRTRLLMINSPHNPSGAMLSAEDMHTLTELLRGTEIFLLSDEVY
EHIVFDGRQHESVLRWPALRERAFVISSFGKTYHCTGWKIGYAIAPPALT
AEFRKVHQYNTFTSFGPAQHAFAAMIRYEPEHDEQLGAFYQAKRDRFREQ
LLTTRLKPLPVPGGYFQLVDYSAISDLPDTEFVKWLTIEKGVAAIPLSPF
YENAPAGQRLARLCFAKNDATLDAAIERLQRL
XFF4834R

XFF4834R_chr06390 lcl|XFF4834R_chr06650106_0729290_r2_XFF4834R-XFF4834R_chr06390

15

381

S=269 I=31 E=4.89282e-26

XFF4834R

XFF4834R_chr11530 lcl|XFF4834R_chr11990091_1285446_r1_XFF4834R-XFF4834R_chr11530

28

350

S=203 I=26 E=4.9028e-18

predicted aminotransferase

XFF4834R

XFF4834R_chr12240 lcl|XFF4834R_chr12890671_1386873_f1_XFF4834R-XFF4834R_chr12240

93

262

S=137 I=28 E=4.58182e-10

XFF4834R

XFF4834R_chr28800 lcl|XFF4834R_chr31420498_3321556_f2_XFF4834R-XFF4834R_chr28800

86

253

S=117 I=28 E=1.37218e-07

XFF4834R

XFF4834R_chr20030 lcl|XFF4834R_chr21480336_2296619_f3_XFF4834R-XFF4834R_chr20030

57

382

S=115 I=24 E=2.63876e-07

XFF4834R

XFF4834R_chr07450 lcl|XFF4834R_chr07860955_0862355_r2_XFF4834R-XFF4834R_chr07450

58

283

S=106 I=25 E=3.11158e-06

fused predicted DNA-binding transcriptional regulator/predicted amino transferase

XFF4834R

XFF4834R_chr19750 lcl|hisC-XFF4834R_chr19750

85

257

S=95 I=25 E=6.19087e-05

histidinol-phosphate aminotransferase

XFF4834R

NP_642639.1 lcl|ybdL-XAC2322

1

382

S=1997 I=98 E=0

putative aminotransferase

XFF4834R

YP_364252.1 lcl|XCV2521

1

382

S=1965 I=96 E=0

putative aminotransferase

XFF4834R

NP_637574.1 lcl|ybdL-XCC2218

1

382

S=1922 I=94 E=0

putative aminotransferase

XFF4834R

lcl|XALc_1299

1

382

S=1742 I=85 E=0

putative aminotransferase protein

XFF4834R

NP_638849.1 lcl|aspC-XCC3503

23

381

S=269 I=30 E=2.07236e-25

hypothetical protein

XFF4834R

NP_640983.1 lcl|aspC-XAC0630

15

381

S=261 I=30 E=1.80102e-24

hypothetical protein

XFF4834R

YP_362417.1 lcl|aspC-XCV0686

15

381

S=261 I=30 E=1.89774e-24

hypothetical protein

XFF4834R

YP_365353.1 lcl|XCV3622

28

350

S=190 I=25 E=7.74016e-16

aminotransferase AlaT

XFF4834R

NP_643801.1 lcl|aspC-XAC3494

28

350

S=190 I=25 E=7.80794e-16

aminotransferase AlaT

XFF4834R

YP_364063.1 lcl|XCV2332

36

379

S=185 I=26 E=3.17807e-15

putative aminotransferase

pubmed

2

382

S=1049 I=56 E=2.10561e-118

Putative uncharacterized protein ybdL

Pubmed 16563686

 

prodomImg

pubmed

6

380

S=742 I=42 E=4.03002e-81

Os09g0453800 protein cDNA clone:J013050C15, full insert sequence Aminotransferase Putative cysteine conjugate beta-lyase

Pubmed 15781441

 

prodomImg

pubmed

10

381

S=636 I=36 E=2.44651e-68

Cysteine conjugate beta-lyase

Pubmed 10369878

 

prodomImg

pubmed

13

377

S=620 I=37 E=1.94703e-66

Kynurenine--oxoglutarate transaminase 3 EC=2.6.1.7 EC=4.4.1.13 ; Aminotransferase Lyase Pyridoxal phosphate

Pubmed 16376499

 

prodomImg

pubmed

3

380

S=618 I=39 E=4.04986e-66

Aminotransferase-like protein Cg0931 PROBABLE PYRIDOXAL PHOSPHATE AMINOTRANSFERASE EC=2.6.1.-

Pubmed 12948641

 

prodomImg

pubmed

6

380

S=614 I=35 E=1.05671e-65

Kynurenine--oxoglutarate transaminase 3 EC=2.6.1.7 EC=4.4.1.13 ; Alternative splicing Aminotransferase Lyase Polymorphism Pyridoxal phosphate

Pubmed 16376499

 

prodomImg

pubmed

6

377

S=597 I=35 E=1.30049e-63

Kynurenine--oxoglutarate transaminase 3 EC=2.6.1.7 EC=4.4.1.13 ; Alternative splicing Aminotransferase Lyase Pyridoxal phosphate

Pubmed 16376499

 

prodomImg

pubmed

20

381

S=563 I=35 E=1.65454e-59

Kynurenine--oxoglutarate transaminase 1 EC=2.6.1.7 EC=2.6.1.64 EC=4.4.1.13 ; Alternative splicing Aminotransferase Cytoplasm Lyase Pyridoxal phos

Pubmed 7883047

 

prodomImg

pubmed

26

380

S=551 I=36 E=5.65213e-58

Aminotransferase

Pubmed 17317567,14982786

 

prodomImg

pubmed

6

381

S=549 I=32 E=8.74052e-58

Kynurenine--oxoglutarate transaminase 1, mitochondrial EC=2.6.1.7 EC=2.6.1.64 EC=4.4.1.13 ; Alternative splicing Aminotransferase Cytoplasm Lyase Mito

Pubmed 8502223,7926014

 

prodomImg

Iprscan IPR015421 [G3DSA:3.40.640.10]

40

284

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan IPR004839 [PF00155]

25

379

Aminotransferase, class I/II

PD518305

1

57

S=199 I=67 E=1.19324e-16

PDA20063

272

318

S=175 I=72 E=1.20067e-13

PDA3X3Z5

284

369

S=138 I=41 E=2.93755e-09

PDA1H233

180

217

S=133 I=68 E=1.2167e-08

PDA764N5

53

100

S=123 I=54 E=2.10558e-07

PD575304

326

381

S=121 I=47 E=3.91033e-07

PDA498B8

293

380

S=120 I=34 E=4.45668e-07

PDA4E1V6

280

378

S=117 I=31 E=1.11325e-06

PDA7V2I5

143

172

S=107 I=63 E=1.79676e-05

PD706276

147

185

S=106 I=49 E=2.43791e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one DATHZ2dd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

277 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

7 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr23260.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr23260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr23260.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr23260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr25530530_2703732_f1_XFF4834R-XFF4834R_chr23360 XFF4834R_chr23360
XFF4834R_chr23350
XFF4834R_chr23350
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23370
XFF4834R_chr23370
ID XFF4834R_chr25530530_2703732_f1_XFF4834R-XFF4834R_chr23360
AC XFF4834R_chr23360
LT XFF4834R_chr23360
OR XFF4834R_chr from 2702530 to 2703732 on strand +
DE probable homoserine O-acetyltransferase
IP Alpha/beta hydrolase fold-1
CL 1.5.1.9 Methionine GO:0009086
EC
GO InterPro
Biological Process: methionine biosynthetic process (GO:0009086)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: O-acetyltransferase activity (GO:0016413)
Molecular Function: homoserine O-acetyltransferase activity (GO:0004414)

Curated
PM
AN metX (nom donne pour les orthologues chez les autres xantho EC2.3.1.31) correspond a une autre fn chez coli (EC2.5.1.6) methionine adenosyltransferase 1 ou tRNA-initiator Met(CAU) (Initiator methionine tRNAf1) , donc pas de nom de gene donne ici
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 42895 Da
SQ 400 aa
 
........10........20........30........40........50
| | | | |
MTEFIPAGTLYHALPSPFPMKRGGVLHQARVAYETWGTLAADRSNAILIV
TGLSPNAHAAANQANPEPGWWEAMLGPGKPIDTARWFVVCVNSLGSCKGS
TGPASVNPATGAPYRLTFPDLSIEDVADAAADVVRALGIAQLACLIGNSM
GGMTALALLLRHPGIARSHINISGSAQALPFSIAIRSLQREAIRLDPHWN
GGHYDDVRYPESGMRMARKLGVITYRSALEWDGRFGRVRLDSEQAADDPF
GLEFQVESYLEGHARRFVRFFDPNCYLYLSRSMDWFDLAEYVDDEPAANV
GMDSPGAAALPASAKPETGISTAATVLAGLARIRIARALAIGANTDILFP
VQQQEQIADGLRAGGADAQFIGLDSPQGHDAFLVDFARFGPAVSDFLQDC
Show or not Domain decomposition
 
Hamap METX_MF_00296 raw_score=8284 norm_score=44.045

Homoserine O-acetyltransferase [metX].

XFF4834R

XFF4834R_chr16000 lcl|XFF4834R_chr17220217_1848248_f3_XFF4834R-XFF4834R_chr16000

18

284

S=141 I=24 E=1.79395e-10

XFF4834R

YP_364262.1 lcl|metX-XCV2531

1

400

S=1797 I=86 E=0

homoserine O-acetyltransferase

XFF4834R

NP_642649.1 lcl|metX-XAC2332

1

400

S=1789 I=86 E=0

homoserine O-acetyltransferase

XFF4834R

NP_637584.1 lcl|metX-XCC2228

1

400

S=1582 I=78 E=0

homoserine O-acetyltransferase

XFF4834R

lcl|metX-XALc_1289

1

300

S=1250 I=79 E=2.71538e-144

probable homoserine o-acetyltransferase (homoserine transacetylase) protein

XFF4834R

lcl|metX-XALc_1289

344

397

S=253 I=89 E=2.00843e-23

probable homoserine o-acetyltransferase (homoserine transacetylase) protein

XFF4834R

lcl|XALc_2186

18

284

S=160 I=26 E=3.05075e-12

putative homoserine o-acetyltransferase protein

XFF4834R

NP_638205.1 lcl|metA-XCC2857

18

284

S=155 I=25 E=1.18878e-11

homoserine O-acetyltransferase

XFF4834R

YP_364908.1 lcl|XCV3177

18

284

S=143 I=24 E=4.31659e-10

homoserine O-acetyltransferase

XFF4834R

NP_643349.1 lcl|metA-XAC3040

18

284

S=142 I=24 E=5.65618e-10

homoserine O-acetyltransferase

pubmed

17

288

S=595 I=43 E=2.56825e-63

Putative serine O-acetyltransferase

Pubmed 11021945

 

prodomImg

pubmed

17

288

S=586 I=43 E=3.16337e-62

L-homoserine-O-acetyltransferase

Pubmed 19129631

 

prodomImg

pubmed

14

287

S=493 I=39 E=5.87204e-51

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 19077236

 

prodomImg

pubmed

17

287

S=492 I=40 E=7.56132e-51

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 18460806

 

prodomImg

pubmed

17

287

S=475 I=37 E=8.60339e-49

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 10913262

 

prodomImg

pubmed

20

288

S=425 I=35 E=1.01912e-42

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 9209059

 

prodomImg

pubmed

20

397

S=415 I=34 E=1.58845e-41

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 18192381

 

prodomImg

pubmed

17

289

S=408 I=36 E=1.04438e-40

Homoserine-ortho-acyltransferase ; Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 11479715

 

prodomImg

pubmed

1

288

S=364 I=33 E=2.20132e-35

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Pubmed 9666465

 

prodomImg

pubmed

70

288

S=339 I=37 E=2.334e-32

Homoserine O-acetyltransferase

Pubmed 17511874

 

prodomImg

sp_Pdown

sp|Q3BSK1|METX_XANC5

1

400

S=1797 I=86 E=0

Homoserine O-acetyltransferase EC=2.3.1.31 ; Acyltransferase Amino-acid biosynthesis Cytoplasm Methionine

Iprscan [G3DSA:3.40.50.1820]

88

397

-

Iprscan [MF_00296]

1

399

-

Iprscan IPR008220 [PIRSF000443]

4

399

Homoserine acetyltransferase

Iprscan IPR000073 [PF00561]

86

163

Alpha/beta hydrolase fold-1

Iprscan IPR006296 [TIGR01392]

14

398

Homoserine O-acetyltransferase

Iprscan [seg]

56

65

-

Iprscan [seg]

125

134

-

Iprscan [seg]

327

343

-

PD004409

18

123

S=287 I=52 E=2.39643e-27

PDA548N3

1

98

S=137 I=31 E=3.58748e-09

PDA870F6

150

193

S=126 I=50 E=8.49749e-08

PD187079

254

289

S=119 I=61 E=5.78524e-07

PDA38830

1

22

S=116 I=100 E=1.34776e-06

PDA0Q7E1

344

397

S=115 I=43 E=1.86086e-06

PD229430

137

195

S=108 I=44 E=1.20233e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LGGdh5wC)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

37 hits
swiss-prot

Swiss-Prot ncbi-blastp

186 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr23360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr23360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr23360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB6_m5R1/XFF4834R_chr23360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
mmuM XFF4834R_chr31050
XFF4834R_chr31040
XFF4834R_chr31040
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31060
XFF4834R_chr31060
ID mmuM
AC XFF4834R_chr31050
LT XFF4834R_chr31050
OR XFF4834R_chr from 3573841 to 3574806 on strand -
DE probable homocysteine S-methyltransferase
IP Homocysteine S-methyltransferase
CL 1.5.1.9 Methionine GO:0009086
EC
GO InterPro
Molecular Function: homocysteine S-methyltransferase activity (GO:0008898)

Curated
PM
AN GenProtEC : Metabolism --> Building block biosynthesis --> Amino acids --> Methionine Metabolism --> Central intermediary metabolism --> Glycerol metabolism extrachromosomal --> Prophage genes and phage related functions
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120405)
MW 34161.4 Da
SQ 321 aa
 
........10........20........30........40........50
| | | | |
MTILPRQPRPNAPFSQALQHDGYVVLDGALATELEQRGCDLNDALWSARV
LMEQPELIYQVHRDYFAAGAQCAITASYQATPLGFAARGLDVAQAQALIA
RSVALAVQARADHLTLHPHAAPLWVAGSVGPYGAYLADGSEYRGDYVLPI
EQLMDFHRPRIAALAEAGVDLLACETLPSASEIVALRQLLQHEFPQLHAW
FSFTLRDAAHLSDGAPLAQVVPALDACAQVIAVGVNCIALDQATAALHSL
SALTALPLVVYPNSGEHYDASDKRWHAGRGAALTLADQHAHWLAAGARLI
GGCCRTAPRDIAALAAARAAE
XFF4834R

XFF4834R_chr_3118 lcl|XFF4834R_chr32080298_3394437_f1_XFF4834R-XFF4834R_chr_3118

50

237

S=115 I=27 E=1.90943e-07

XFF4834R

XFF4834R_chr_3118 lcl|XFF4834R_chr32080298_3394437_f1_XFF4834R-XFF4834R_chr_3118

50

237

S=115 I=27 E=1.90943e-07

pubmed

22

304

S=595 I=45 E=1.75548e-63

Homocysteine S-methyltransferase 2 EC=2.1.1.10 ; Amino-acid biosynthesis Metal-binding Methionine S-adenosyl-L-methionine Zinc

Pubmed 11309147

 

prodomImg

pubmed

22

304

S=580 I=42 E=1.14322e-61

Homocysteine S-methyltransferase 3 EC=2.1.1.10 ; Amino-acid biosynthesis Metal-binding Methionine S-adenosyl-L-methionine Zinc

Pubmed 11309147

 

prodomImg

pubmed

22

304

S=578 I=40 E=1.94584e-61

Selenocysteine methyltransferase

Pubmed 15863700

 

prodomImg

pubmed

22

304

S=578 I=44 E=2.0149e-61

Homocysteine S-methyltransferase 3 EC=2.1.1.10 ; Amino-acid biosynthesis Metal-binding Methionine S-adenosyl-L-methionine Zinc

Pubmed 11309147

 

prodomImg

pubmed

19

304

S=575 I=40 E=4.53314e-61

Homocysteine S-methyltransferase 2 EC=2.1.1.10 ; Alternative splicing Amino-acid biosynthesis Metal-binding Methionine S-adenosyl-L-methionine

Pubmed 10747987

 

prodomImg

pubmed

22

304

S=547 I=44 E=1.29861e-57

Homocysteine S-methyltransferase 4 EC=2.1.1.10 ; Amino-acid biosynthesis Metal-binding Methionine S-adenosyl-L-methionine Zinc

Pubmed 11309147

 

prodomImg

pubmed

25

304

S=535 I=41 E=3.89238e-56

Selenocysteine methyltransferase EC=2.1.1.- ; Metal-binding Zinc

Pubmed 10026151

 

prodomImg

pubmed

22

304

S=530 I=43 E=1.53002e-55

Homocysteine S-methyltransferase 1 EC=2.1.1.10 ; Amino-acid biosynthesis Metal-binding Methionine S-adenosyl-L-methionine Zinc

Pubmed 11309147

 

prodomImg

pubmed

22

304

S=530 I=41 E=1.57056e-55

Homocysteine S-methyltransferase 1 EC=2.1.1.10 ; Alternative splicing Amino-acid biosynthesis Metal-binding Methionine S-adenosyl-L-methionine

Pubmed 10747987

 

prodomImg

pubmed

22

304