Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr19650thrAXFF4834R_chr19650bifunctional aspartokinase I and homoserine dehydrogenase I protein
  2. XFF4834R_chr19660thrBXFF4834R_chr19660homoserine kinase
  3. XFF4834R_chr19680thrCXFF4834R_chr19680threonine synthase

thrA XFF4834R_chr19650
XFF4834R_chr19640
XFF4834R_chr19640
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19660
XFF4834R_chr19660
ID thrA
AC XFF4834R_chr19650
LT XFF4834R_chr19650
OR XFF4834R_chr from 2256505 to 2259012 on strand +
DE bifunctional aspartokinase I and homoserine dehydrogenase I protein
IP Aspartate/glutamate/uridylate kinase; NAD(P)-binding domain; Aspartate kinase, conserved site; Homoserine dehydrogenase, conserved site
CL 1.5.1.8 Threonine GO:0009088
EC
GO InterPro
Biological Process: cellular amino acid metabolic process (GO:0006520)
Biological Process: metabolic process (GO:0008152)
Biological Process: aspartate family amino acid biosynthetic process (GO:0009067)
Biological Process: cellular amino acid biosynthetic process (GO:0008652)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: homoserine dehydrogenase activity (GO:0004412)
Molecular Function: binding (GO:0005488)
Molecular Function: aspartate kinase activity (GO:0004072)
Molecular Function: amino acid binding (GO:0016597)
Molecular Function: NADP or NADPH binding (GO:0050661)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110309)
MW 89003 Da
SQ 835 aa
 
........10........20........30........40........50
| | | | |
MSSPAVSFEPAAVLASSARTVVHKFGGTSVADAERYRHVAQLLLARDETV
QVTVVSAMKGVTDALIELAELAAKNRPEWRERWHEARARHRGAAVALLGE
HSGPTVEWLDERFEHLSQILGALAVIGELPREVLDRVQGLGEVYSAQLLG
DHFRAIGEDCAVLDARDVLVVNRGELGVDVDWEASAQRLATWRQAHPQTR
VVVTGFVARDRADRITTLGRNGSDYSGAIFAALFDADELHIWTDVDGVLS
ADPRVVPEAVQLETLSYDEACELAYFGAKVVHPQTMSPAIERGLPIIIRN
TFQPEHPGTRITASSAVSGPIKGLTLSPDLAVLNLEGTGLIGVPGTAERV
FAALRTAQVSVVMISQGSSEHSICCVVKQHESERARNALLQAFAHELTVG
QVQRVQLTTGISVLAAVGDGMAGQPGVAARLFESLGRAQVNILAIAQGSS
ERNISVAIDAAHATKALRAAHAGFWLSPQTFSVGVIGPGNVGAALLDQLR
VAQPQLLGKANLDLRLRAVVSRGRMLLDERGLVGDWRDAFASATTATDLE
RFTAHLLSAHLPHTVIIDCSGSAEVADRYAGWLAAGIHVVTPNKQAGSGP
LARYEAICAAADASGARFRYEATVGAGLPVITTLRDLVDTGDAVTSIEGI
FSGTLAWLFNKYDGSVPFAELVTQARGMGYTEPDPRDDLSGVDVARKLVI
LAREAGRSISLEDVQVESLVPEALRQASVDDFMARLPEVDAAFAQRLADA
RARGNVLRYVAQLPPDRAPSVGLVELPADHAFANLRLTDNVVQFTTRRYC
ENPLVVQGPGAGPEVTAAGVFADLLRVAAGEGARL
XFF4834R

XFF4834R_chr16020 lcl|XFF4834R_chr_1849459_1850547_f1_XFF4834R-XFF4834R_chr16020

565

830

S=567 I=47 E=8.57492e-62

XFF4834R

XFF4834R_chr17280 lcl|lysA-XFF4834R_chr17280

109

459

S=362 I=31 E=6.5216e-37

diaminopimelate decarboxylase, PLP-binding

XFF4834R

XFF4834R_chr23480 lcl|proB-XFF4834R_chr23480

223

263

S=99 I=56 E=4.84582e-05

gamma-glutamate kinase

XFF4834R

NP_642146.1 lcl|metL-XAC1820

1

835

S=3984 I=93 E=0

bifunctional aspartokinase I/homeserine dehydrogenase I

XFF4834R

YP_363597.1 lcl|thrA-XCV1866

1

835

S=3982 I=93 E=0

bifunctional aspartokinase I/homeserine dehydrogenase I

XFF4834R

NP_637165.1 lcl|metL-XCC1800

1

835

S=3878 I=91 E=0

bifunctional aspartokinase I/homeserine dehydrogenase I

XFF4834R

lcl|thrA-XALc_1240

30

835

S=3424 I=82 E=0

putative bifunctional aspartokinase/homoserine dehydrogenaseI(aki-hdi) protein

XFF4834R

NP_638203.2 lcl|XCC2855

565

830

S=585 I=48 E=2.24778e-63

homoserine dehydrogenase

XFF4834R

YP_364906.1 lcl|metL-XCV3175

565

830

S=580 I=48 E=9.6405e-63

homoserine dehydrogenase

XFF4834R

lcl|XALc_2184

565

831

S=573 I=48 E=7.28734e-62

putative homoserine dehydrogenase protein

XFF4834R

NP_643347.2 lcl|XAC3038-XAC3038

565

830

S=571 I=48 E=1.35335e-61

homoserine dehydrogenase

XFF4834R

NP_643220.1 lcl|lysA-XAC2911

16

459

S=403 I=30 E=2.86662e-41

bifunctional aspartate kinase/diaminopimelate decarboxylase protein

XFF4834R

YP_364787.1 lcl|lysA-XCV3056

16

459

S=398 I=30 E=9.97332e-41

bifunctional aspartate kinase/diaminopimelate decarboxylase protein

pubmed

3

833

S=1689 I=43 E=0

Aspartokinase-homoserine dehydrogenase EC=1.1.1.3 EC=2.7.2.4 ; Chloroplast Oxidoreductase Transferase

Pubmed 10409053

 

prodomImg

pubmed

3

828

S=1679 I=43 E=0

Aspartokinase-homoserine dehydrogenase ; Transferase

Pubmed 10409053

 

prodomImg

pubmed

22

833

S=1654 I=42 E=0

Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic EC=2.7.2.4 EC=1.1.1.3 ; Alternative splicing Amino-acid biosynthesis ATP-

Pubmed 11812230

 

prodomImg

pubmed

22

833

S=1644 I=43 E=0

Bifunctional aspartokinase/homoserine dehydrogenase, chloroplastic EC=2.7.2.4 EC=1.1.1.3 ; Amino-acid biosynthesis ATP-binding Methionine Multifunctional enzyme N

Pubmed 8507831

 

prodomImg

pubmed

22

833

S=1631 I=42 E=0

Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic EC=2.7.2.4 EC=1.1.1.3 ; Amino-acid biosynthesis ATP-binding Methionine Multifunctio

Pubmed 7846152

 

prodomImg

pubmed

22

833

S=1614 I=42 E=0

Bifunctional aspartokinase/homoserine dehydrogenase 1, chloroplastic EC=2.7.2.4 EC=1.1.1.3 ; Amino-acid biosynthesis ATP-binding Methionine Mu

Pubmed 11812230

 

prodomImg

pubmed

22

833

S=1584 I=42 E=0

Bifunctional aspartokinase/homoserine dehydrogenase 2, chloroplastic EC=2.7.2.4 EC=1.1.1.3 ; Amino-acid biosynthesis ATP-binding Methionine Multifunctio

Pubmed 7846152

 

prodomImg

pubmed

22

826

S=1357 I=40 E=2.91468e-155

Bifunctional aspartokinase/homoserine dehydrogenase 1 EC=2.7.2.4 EC=1.1.1.3 ; Allosteric enzyme Amino-acid biosynthesis ATP-binding Multifunctional NADP

Pubmed 8423151

 

prodomImg

pubmed

22

826

S=1349 I=39 E=2.34189e-154

Bifunctional aspartokinase/homoserine dehydrogenase 1 EC=2.7.2.4 EC=1.1.1.3 ; Allosteric enzyme Amino-acid biosynthesis ATP-binding Multifunctional

Pubmed 7003595,1630901

 

prodomImg

pubmed

22

828

S=1205 I=30 E=8.10321e-137

Aspartokinase/homoserine dehydrogenase ; Transferase

Pubmed 18048332

 

prodomImg

Iprscan IPR001048 [G3DSA:3.40.1160.10]

128

313

Aspartate/glutamate/uridylate kinase

Iprscan IPR016040 [G3DSA:3.40.50.720]

477

662

NAD(P)-binding domain

Iprscan IPR011147 [PIRSF000727]

1

832

Bifunctional aspartokinase/homoserine dehydrogenase I

Iprscan IPR001048 [PF00696]

19

300

Aspartate/glutamate/uridylate kinase

Iprscan IPR002912 [PF01842]

344

394

Amino acid-binding ACT

Iprscan IPR002912 [PF01842]

415

475

Amino acid-binding ACT

Iprscan IPR005106 [PF03447]

487

621

Aspartate/homoserine dehydrogenase, NAD-binding

Iprscan IPR001342 [PF00742]

629

825

Homoserine dehydrogenase, catalytic

Iprscan IPR001341 [TIGR00657]

18

476

Aspartate kinase region

Iprscan IPR018042 [PS00324]

22

30

Aspartate kinase, conserved site

Iprscan IPR019811 [PS01042]

675

697

Homoserine dehydrogenase, conserved site

Iprscan [seg]

79

99

-

Iprscan [seg]

460

472

-

Iprscan [seg]

741

753

-

PDA1F8K3

637

683

S=180 I=62 E=3.24729e-14

PDA008P4

575

720

S=178 I=24 E=5.77339e-14

PD002589

576

661

S=164 I=44 E=3.24188e-12

PD868437

684

722

S=159 I=79 E=1.19887e-11

PD891465

208

362

S=155 I=29 E=3.53426e-11

PD694897

477

572

S=145 I=36 E=5.2737e-10

PDA011H8

183

336

S=129 I=30 E=5.12897e-08

PD189653

410

459

S=128 I=52 E=6.66232e-08

PD189653

330

393

S=118 I=39 E=1.22551e-06

PD387689

118

223

S=124 I=32 E=1.9986e-07

PD000447

239

273

S=117 I=60 E=1.47175e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Jv1fkYc4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

65 hits
swiss-prot

Swiss-Prot ncbi-blastp

58 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
thrB XFF4834R_chr19660
XFF4834R_chr19650
XFF4834R_chr19650
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19670
XFF4834R_chr19670
ID thrB
AC XFF4834R_chr19660
LT XFF4834R_chr19660
OR XFF4834R_chr from 2259009 to 2260028 on strand +
DE homoserine kinase
IP Homoserine kinase; Phosphomevalonate kinase, ERG8
CL 1.5.1.8 Threonine GO:0009088
EC
GO InterPro
Biological Process: phosphorylation (GO:0016310)
Biological Process: threonine metabolic process (GO:0006566)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: homoserine kinase activity (GO:0004413)
Molecular Function: kinase activity (GO:0016301)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110309)
MW 34500.7 Da
SQ 339 aa
 
........10........20........30........40........50
| | | | |
MTQTVVSQAGVSQAAVAQAQAQGSDRASPGKHGLHEARAFAPASVANVAV
GFDLLGYPIDGVGDTVTVRRIEAPVVRIAAIRGTTVALPLDAERNTAGAA
LISLRAALQLPYGFEIEIDKGIALSSGMGGSAASCVAALVAANALLASPL
DHHQLYQYALDGEAVASGSRHGDNLGPLFAGGLVLCTLERLVPIAVPAAW
HSLLVHPDAVLETRRAREALAGNYQLREFVAQSTNLALVLAGCHAGDADL
VRAGLRDVLIEPRRAPLIAGFADAKQAALDHNALGASISGAGPSAFAWFE
SRAAAEAAAPAVQAGFAAVGFDSQAWVSPIASPAARLLG
XFF4834R

YP_363598.1 lcl|thrB-XCV1867

25

339

S=1227 I=80 E=1.32261e-141

homoserine kinase

XFF4834R

NP_642147.2 lcl|thrB-XAC1821

24

338

S=1216 I=79 E=2.99917e-140

homoserine kinase

XFF4834R

NP_637166.1 lcl|thrB-XCC1801

27

338

S=1025 I=72 E=4.67029e-117

homoserine kinase

XFF4834R

lcl|thrB-XALc_1241

35

338

S=813 I=62 E=2.03128e-91

putative homoserine kinase (hsk) (hk) protein

pubmed

38

293

S=280 I=35 E=2.96605e-25

Homoserine kinase EC=2.7.1.39 ; ATP-binding Nucleotide-binding Transferase

Pubmed 10562426

 

prodomImg

pubmed

38

275

S=272 I=30 E=2.83716e-24

Homoserine kinase ; ATP-binding Nucleotide-binding Transferase

Pubmed 18048332

 

prodomImg

pubmed

38

293

S=240 I=29 E=2.31389e-20

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

Pubmed 8423151

 

prodomImg

pubmed

38

293

S=230 I=26 E=3.13695e-19

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

Pubmed 17038625

 

prodomImg

pubmed

41

293

S=230 I=29 E=3.51344e-19

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

Pubmed 16857943

 

prodomImg

pubmed

38

293

S=229 I=29 E=4.44599e-19

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

Pubmed 6259626,1630901

 

prodomImg

pubmed

36

293

S=211 I=26 E=7.10745e-17

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

Pubmed 11188689

 

prodomImg

pubmed

41

293

S=211 I=28 E=7.68763e-17

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

Pubmed 16820047

 

prodomImg

pubmed

38

293

S=200 I=25 E=1.30739e-15

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

Pubmed 9569646

 

prodomImg

pubmed

38

293

S=200 I=28 E=1.49006e-15

Homoserine kinase EC=2.7.1.39 ; ATP-binding Amino-acid biosynthesis Cytoplasm Nucleotide-binding Threonine Transferase

Pubmed 7003595,6259626

 

prodomImg

sp_Pdown

sp|Q8P9Q0|KHSE_XANCP

27

338

S=1025 I=72 E=1.21714e-115

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

sp_Pdown

sp|B0RSK6|KHSE_XANCB

27

338

S=1021 I=72 E=3.01395e-115

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

sp_Pdown

sp|Q4UU32|KHSE_XANC8

27

338

S=1019 I=72 E=6.32396e-115

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

sp_Pdown

sp|Q9PBC0|KHSE_XYLFA

35

338

S=899 I=64 E=1.95859e-100

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

sp_Pdown

sp|Q87C24|KHSE_XYLFT

35

338

S=893 I=63 E=1.12007e-99

Homoserine kinase EC=2.7.1.39 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Threonine Transferase

Iprscan IPR014721 [G3DSA:3.30.230.10]

35

146

Ribosomal protein S5 domain 2-type fold, subgroup

Iprscan [G3DSA:1.10.8.90]

147

200

-

Iprscan IPR000870 [PIRSF000676]

35

338

Homoserine kinase

Iprscan IPR006204 [PF00288]

115

182

GHMP kinase

Iprscan IPR013750 [PF08544]

239

318

GHMP kinase, C-terminal

Iprscan [seg]

2

23

-

Iprscan [seg]

121

148

-

Iprscan [seg]

294

321

-

PD860865

199

271

S=345 I=95 E=2.33589e-34

PD124414

207

293

S=154 I=39 E=3.3048e-11

PD874870

149

205

S=112 I=48 E=3.88396e-06

PD933681

207

293

S=106 I=32 E=2.44471e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6uyQv4ng)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

47 hits
swiss-prot

Swiss-Prot ncbi-blastp

173 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19660.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19660.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19660.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
thrC XFF4834R_chr19680
XFF4834R_chr19670
XFF4834R_chr19670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19690
XFF4834R_chr19690
ID thrC
AC XFF4834R_chr19680
LT XFF4834R_chr19680
OR XFF4834R_chr from 2260579 to 2261883 on strand +
DE threonine synthase
IP Serine/threonine dehydratase, pyridoxal-phosphate-binding site
CL 1.5.1.8 Threonine GO:0009088
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: cellular amino acid metabolic process (GO:0006520)
Biological Process: threonine biosynthetic process (GO:0009088)
Molecular Function: threonine synthase activity (GO:0004795)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: pyridoxal phosphate binding (GO:0030170)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110309)
MW 45230.8 Da
SQ 434 aa
 
........10........20........30........40........50
| | | | |
MFISTRGGAPAASLSQAIAAGLAPDGGLYVPQTLPPARTLVAGAGLADTA
TALLQPFFEGDALAAELPAICAEAFDFPAPLVALGTPGDYALELFHGPTA
AFKDFGARFLATCLTRLRRAEDRPLTILVATSGDTGAAVAAAFHRQPGLR
VVVLYPDSRVSPRQAHQLGCFGDNIQALRVAGSFDDCQAMVKQALNDAAL
QTQVPLSSANSISLGRLLPQMSYYAHAALEHHAASGSVLNLVVPTGNLGN
ALAAIIARALGVPLGRIALASNANHVLPDYFAGDAYVPQPSVATLANAMD
VGAPSNFERLRWLYNGDDAALREEFRALSVDDAAIRHTVQQRFARYGEVH
CPHTATAVHVLEQLRAEGAEGGTGDWAVAATAHPAKFEGVVEPLIGRAVE
VPPALAALLQRPAQAEALAADYAALRQRLLADAA
Show or not Domain decomposition
 
XFF4834R

NP_642149.2 lcl|thrC-XAC1823

1

403

S=1769 I=88 E=0

threonine synthase

XFF4834R

YP_363600.1 lcl|thrC-XCV1869

1

403

S=1765 I=88 E=0

threonine synthase

XFF4834R

NP_637168.2 lcl|thrC-XCC1803

1

403

S=1731 I=83 E=0

threonine synthase

XFF4834R

lcl|thrC-XALc_1246

2

402

S=1512 I=74 E=4.99113e-176

putative threonine synthase protein

pubmed

74

402

S=616 I=42 E=7.81383e-66

Threonine synthase EC=4.2.3.1 ; Amino-acid biosynthesis Lyase Pyridoxal phosphate

Pubmed 8423151

 

prodomImg

pubmed

92

402

S=595 I=41 E=3.1476e-63

Threonine synthase EC=4.2.3.1 ; Amino-acid biosynthesis Lyase Pyridoxal phosphate

Pubmed 6316258,1630901

 

prodomImg

pubmed

58

392

S=590 I=41 E=1.1539e-62

Threonine synthase

Pubmed 10954745

 

prodomImg

pubmed

58

392

S=588 I=41 E=1.94697e-62

Threonine synthase

Pubmed 10954745

 

prodomImg

pubmed

58

392

S=579 I=40 E=2.2759e-61

Threonine synthase

Pubmed 10954745

 

prodomImg

pubmed

92

392

S=575 I=42 E=7.19403e-61

Threonine synthase

Pubmed 10954745

 

prodomImg

pubmed

92

392

S=575 I=42 E=7.84941e-61

Threonine synthase

Pubmed 10954745

 

prodomImg

pubmed

92

392

S=575 I=42 E=7.91815e-61

Threonine synthase

Pubmed 10954745

 

prodomImg

pubmed

92

392

S=575 I=42 E=7.91815e-61

Threonine synthase

Pubmed 10954745

 

prodomImg

pubmed

92

392

S=575 I=42 E=8.05743e-61

Threonine synthase

Pubmed 10954745

 

prodomImg

sp_Pdown

sp|P57289|THRC_BUCAI

66

402

S=631 I=39 E=7.31181e-68

Threonine synthase EC=4.2.3.1 ; Amino-acid biosynthesis Lyase Pyridoxal phosphate

sp_Pdown

sp|Q8K9V1|THRC_BUCAP

72

402

S=626 I=39 E=3.54309e-67

Threonine synthase EC=4.2.3.1 ; Amino-acid biosynthesis Lyase Pyridoxal phosphate

sp_Pdown

sp|Q89AR5|THRC_BUCBP

24

402

S=617 I=35 E=3.76292e-66

Threonine synthase EC=4.2.3.1 ; Amino-acid biosynthesis Lyase Pyridoxal phosphate

sp_Pdown

sp|P27735|THRC_SERMA

74

402

S=616 I=42 E=5.37987e-66

Threonine synthase EC=4.2.3.1 ; Amino-acid biosynthesis Lyase Pyridoxal phosphate

sp_Pdown

sp|P44503|THRC_HAEIN

25

402

S=605 I=38 E=1.29672e-64

Threonine synthase EC=4.2.3.1 ; Amino-acid biosynthesis Lyase Pyridoxal phosphate

Iprscan [G3DSA:3.90.1380.10]

1

76

-

Iprscan [G3DSA:3.40.50.1100]

186

408

-

Iprscan IPR001926 [PF00291]

92

382

Pyridoxal phosphate-dependent enzyme, beta subunit

Iprscan IPR004450 [TIGR00260]

49

403

Threonine synthase

Iprscan IPR000634 [PS00165]

93

107

Serine/threonine dehydratase, pyridoxal-phosphate-binding site

Iprscan [seg]

8

23

-

Iprscan [seg]

39

54

-

Iprscan [seg]

225

234

-

Iprscan [seg]

404

434

-

PDA0B539

105

402

S=259 I=25 E=6.60961e-24

PD854752

260

325

S=150 I=46 E=1.19325e-10

PD349826

151

197

S=132 I=48 E=1.56094e-08

PD005074

319

402

S=130 I=39 E=3.02803e-08

PDA0X1K7

70

200

S=129 I=25 E=4.25436e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UbOI32UA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

65 hits
swiss-prot

Swiss-Prot ncbi-blastp

26 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBF9Zp0R/XFF4834R_chr19680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.