Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr06430dapFXFF4834R_chr06430diaminopimelate epimerase
  2. XFF4834R_chr20050dapBXFF4834R_chr20050dihydrodipicolinate reductase
  3. XFF4834R_chr25690dapA2XFF4834R_chr25690probable dihydrodipicolinate synthetase
  4. XFF4834R_chr27200asdXFF4834R_chr27200probable aspartate-semialdehyde dehydrogenase
  5. XFF4834R_chr27520dapA1XFF4834R_chr27520dihydrodipicolinate synthase

dapF XFF4834R_chr06430
XFF4834R_chr06420
XFF4834R_chr06420
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06440
XFF4834R_chr06440
ID dapF
AC XFF4834R_chr06430
LT XFF4834R_chr06430
OR XFF4834R_chr from 732597 to 733451 on strand +
DE diaminopimelate epimerase
IP Diaminopimelate epimerase; Diaminopimelate epimerase, active site
CL 1.5.1.7 Lysine, diaminopimelate GO:0009089
EC
GO InterPro
Biological Process: lysine biosynthetic process via diaminopimelate (GO:0009089)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: diaminopimelate epimerase activity (GO:0008837)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120322)
MW 30091.7 Da
SQ 284 aa
 
........10........20........30........40........50
| | | | |
MSADGRSGRLRFTKMHGAGNDFVVLDLRDGTPPPDAALAAQLADRHFGVG
CDQILTIEAPRSDGAAAAYGIWNSDGSAARQCGNGARCVAAWLVRDGTAQ
GERFIIDSPVTAHAVERLDGDRYAVAMGVPQFEPTQIPLAGFAHARDEYA
LPVHGETVRFGAVSMGNPHAVVEVGRVDAAPVERVGALLQQNAAFPDSVN
VGFAQVVDPAHVRLRVFERGVGETLACGSGACAAAVVLMQRGRVERDVQV
SLPGGELRIRWPGDQEQVVMSGPAVFVFDGEWNR
Hamap DAPF_MF_00197 raw_score=5002 norm_score=35.840

Diaminopimelate epimerase [dapF].

X.species

YP_362420.1 lcl|dapF-XCV0689

1

284

S=1276 I=88 E=1.26108e-147

diaminopimelate epimerase

X.species

NP_640987.1 lcl|dapF-XAC0634

15

284

S=1214 I=89 E=4.068e-140

diaminopimelate epimerase

X.species

NP_638845.1 lcl|dapF-XCC3499

1

284

S=1157 I=80 E=3.39713e-133

diaminopimelate epimerase

X.species

lcl|dapF-XALc_2577

6

282

S=960 I=67 E=2.8214e-109

probable diaminopimelate epimerase protein

pubmed

10

281

S=505 I=42 E=1.14854e-52

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 7715441

 

prodomImg

pubmed

10

280

S=497 I=38 E=1.03358e-51

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 9843410

 

prodomImg

pubmed

10

280

S=496 I=39 E=1.65507e-51

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 3057443,1379743

 

prodomImg

pubmed

10

281

S=487 I=40 E=1.78868e-50

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 9618537

 

prodomImg

pubmed

6

280

S=439 I=33 E=1.39423e-44

Diaminopimelate epimerase ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 15716086

 

prodomImg

pubmed

15

281

S=437 I=40 E=1.99333e-44

Diaminopimelate epimerase ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 15305924

 

prodomImg

pubmed

12

281

S=384 I=36 E=5.50079e-38

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 18700039

 

prodomImg

pubmed

10

281

S=379 I=35 E=2.2586e-37

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 18441057

 

prodomImg

pubmed

9

283

S=314 I=33 E=1.7885e-29

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 16857943

 

prodomImg

pubmed

10

282

S=311 I=30 E=4.05901e-29

Diaminopimelate epimerase 2 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

Pubmed 18226230

 

prodomImg

sp

1

284

S=1288 I=89 E=1.14324e-147

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

 

prodomImg

sp

1

284

S=1276 I=88 E=3.2238e-146

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

 

prodomImg

sp

1

283

S=1216 I=85 E=6.90307e-139

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

 

prodomImg

sp

1

284

S=1157 I=80 E=8.68438e-132

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

 

prodomImg

sp

1

284

S=1157 I=80 E=8.68438e-132

Diaminopimelate epimerase EC=5.1.1.7 ; Amino-acid biosynthesis Cytoplasm Isomerase Lysine

 

prodomImg

Iprscan [G3DSA:3.10.310.10]

124

284

-

Iprscan [MF_00197]

10

284

-

Iprscan IPR001653 [PF01678]

12

109

Diaminopimelate epimerase

Iprscan IPR001653 [PF01678]

161

277

Diaminopimelate epimerase

Iprscan IPR001653 [TIGR00652]

10

284

Diaminopimelate epimerase

Iprscan IPR018510 [PS01326]

73

87

Diaminopimelate epimerase, active site

Iprscan [seg]

32

44

-

Iprscan [seg]

225

238

-

PDA288M5

92

145

S=195 I=65 E=4.28081e-16

PD005029

149

281

S=189 I=42 E=2.16679e-15

PDA1B4C3

144

283

S=172 I=21 E=2.33975e-13

PD576858

12

92

S=154 I=41 E=3.51892e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5ptYvvlH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

20 hits
swiss-prot

Swiss-Prot ncbi-blastp

353 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr06430.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr06430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr06430.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr06430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
dapB XFF4834R_chr20050
XFF4834R_chr20040
XFF4834R_chr20040
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr20060
XFF4834R_chr20060
ID dapB
AC XFF4834R_chr20050
LT XFF4834R_chr20050
OR XFF4834R_chr from 2297698 to 2298414 on strand +
DE dihydrodipicolinate reductase
IP Dihydrodipicolinate reductase; Dihydrodipicolinate reductase, bacterial/plant; NAD(P)-binding domain
CL 1.5.1.7 Lysine, diaminopimelate GO:0009089
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Biological Process: lysine biosynthetic process via diaminopimelate (GO:0009089)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: dihydrodipicolinate reductase activity (GO:0008839)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 24814.1 Da
SQ 238 aa
 
........10........20........30........40........50
| | | | |
MTTSAVKVLIHGASGRMGKALLRLAAEDQTVQVVGAVVGRSPSQRVVDGV
PFFAASELGGAPAFDVAIDFSLPQGFAPILALCAQRGKPLVSGTTGLDEA
QRAALRDAAQQIALVWASNFSLGVAVLTELVERAAGTLPGWDCDILEAHH
VHKQDAPSGTALTLGEAATGSGAQPRYVSLRAGDIVGEHTVQFTGLGERV
ELVHRATNRDIFARGALHAAKRLIGKPAGSYRVRDLVL
Hamap DAPB_MF_00102 raw_score=4155 norm_score=28.807

Dihydrodipicolinate reductase [dapB].

X.species

NP_642186.1 lcl|dapB-XAC1860

1

238

S=1110 I=92 E=1.4955e-127

dihydrodipicolinate reductase

X.species

YP_363637.1 lcl|dapB-XCV1906

1

238

S=1105 I=92 E=5.38769e-127

dihydrodipicolinate reductase

X.species

NP_637205.1 lcl|dapB-XCC1840

1

238

S=1044 I=85 E=1.38546e-119

dihydrodipicolinate reductase

X.species

lcl|dapB-XALc_1337

1

237

S=847 I=71 E=8.93586e-96

probable dihydrodipicolinate reductase (dhpr) protein

pubmed

6

237

S=359 I=40 E=4.71166e-35

Dihydrodipicolinate reductase ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 16483680

 

prodomImg

pubmed

1

237

S=351 I=37 E=4.70772e-34

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 6094578,1630901

 

prodomImg

pubmed

65

237

S=332 I=39 E=9.35879e-32

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 19124572

 

prodomImg

pubmed

7

237

S=332 I=38 E=9.94775e-32

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 14602651

 

prodomImg

pubmed

4

237

S=315 I=29 E=9.34317e-30

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 17038625

 

prodomImg

pubmed

7

237

S=312 I=38 E=2.37493e-29

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 8990304

 

prodomImg

pubmed

6

237

S=305 I=35 E=1.89164e-28

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 15618402

 

prodomImg

pubmed

7

237

S=300 I=37 E=6.9347e-28

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 8169201

 

prodomImg

pubmed

21

238

S=289 I=32 E=1.60018e-26

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 15637156

 

prodomImg

pubmed

6

236

S=288 I=34 E=2.13365e-26

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

Pubmed 11447207

 

prodomImg

sp

1

238

S=1110 I=92 E=3.76336e-126

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

sp

1

238

S=1105 I=92 E=1.35579e-125

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

sp

1

238

S=1044 I=85 E=3.48644e-118

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

sp

1

238

S=1044 I=85 E=3.48644e-118

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

sp

1

238

S=1044 I=85 E=3.48644e-118

Dihydrodipicolinate reductase EC=1.3.1.26 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

7

154

NAD(P)-binding domain

Iprscan [MF_00102]

6

238

-

Iprscan IPR000846 [PF01113]

6

120

Dihydrodipicolinate reductase

Iprscan IPR000846 [PF05173]

123

237

Dihydrodipicolinate reductase

Iprscan IPR011770 [TIGR00036]

5

237

Dihydrodipicolinate reductase, bacterial/plant

Iprscan IPR000846 [PS01298]

144

161

Dihydrodipicolinate reductase

Iprscan [seg]

97

114

-

PD862677

4

58

S=239 I=91 E=1.73944e-21

PD004105

122

238

S=209 I=39 E=7.77319e-18

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one naqq6TPg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

27 hits
swiss-prot

Swiss-Prot ncbi-blastp

446 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr20050.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr20050.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr20050.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr20050.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
dapA2 XFF4834R_chr25690
XFF4834R_chr25680
XFF4834R_chr25680
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25700
XFF4834R_chr25700
ID dapA2
AC XFF4834R_chr25690
LT XFF4834R_chr25690
OR XFF4834R_chr from 2979363 to 2980271 on strand -
DE probable dihydrodipicolinate synthetase
IP Dihydrodipicolinate synthetase; Aldolase-type TIM barrel
CL 1.5.1.7 Lysine, diaminopimelate GO:0009089
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: lyase activity (GO:0016829)

Curated
PM
AN
CC COG: [EM] Amino acid transport and metabolism;Cell wall/membrane/envelope biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110304)
MW 31921.7 Da
SQ 302 aa
 
........10........20........30........40........50
| | | | |
MSNAAFWHGVLPAITTPFTANGDIDHDFLGKHANQLVDAGCTAIVPLGSL
GEAATLSVEDKLAILRTLVTALNGRVPVVPGIASLATGEAVALAKAAKDI
GCGGLMVLPPYVYSTDWREMGAHVRAVIGATDLPVILYNNPVAYKTDFGP
AQIAELAAEFPNLQAVKESSGDVRRFAALQELLGDRLALLVGMDDAIVEG
LSMGAKGWIAGLVNAYPKESVRLFELARDGGYPAARELYHWFLPLLRLDT
VPTFVQLIKLVQAKVGMGSEQVRAPRLVVAGAERDAALKVIDHAIATAPK
LA
XFF4834R

XFF4834R_chr27520 lcl|dapA-XFF4834R_chr27520

9

296

S=295 I=35 E=2.97992e-29

dihydrodipicolinate synthase

XFF4834R

XFF4834R_chr12530 lcl|XFF4834R_chr13180571_1419488_f3_XFF4834R-XFF4834R_chr12530

5

275

S=202 I=29 E=5.87961e-18

XFF4834R

XFF4834R_chr27520 lcl|dapA-XFF4834R_chr27520

9

296

S=295 I=35 E=2.97992e-29

dihydrodipicolinate synthase

XFF4834R

XFF4834R_chr12530 lcl|XFF4834R_chr13180571_1419488_f3_XFF4834R-XFF4834R_chr12530

5

275

S=202 I=29 E=5.87961e-18

pubmed

6

298

S=340 I=33 E=1.21626e-32

Dihydrodipicolinate synthetase ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 3514578

 

prodomImg

pubmed

9

248

S=333 I=34 E=9.52014e-32

Putative uncharacterized protein

Pubmed 14680703

 

prodomImg

pubmed

7

246

S=325 I=31 E=9.67952e-31

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 17563350

 

prodomImg

pubmed

7

295

S=324 I=31 E=1.09362e-30

Putative dihidrodipicolinate synthase EC=4.2.1.52 ; Lyase

Pubmed 11511872

 

prodomImg

pubmed

6

245

S=321 I=34 E=2.59256e-30

Dihydrodipicolinate synthetas ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 16113328

 

prodomImg

pubmed

6

294

S=320 I=28 E=4.11541e-30

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 3514578

 

prodomImg

pubmed

8

275

S=319 I=32 E=5.25334e-30

Dihydrodipicolinate synthase EC=4.2.1.52 ; Lyase

Pubmed 16329940

 

prodomImg

pubmed

4

265

S=313 I=31 E=2.77753e-29

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 18263724

 

prodomImg

pubmed

6

275

S=310 I=29 E=5.38806e-29

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 18700039

 

prodomImg

pubmed

6

275

S=310 I=29 E=6.52733e-29

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 11447207

 

prodomImg

sp

6

247

S=391 I=37 E=6.37117e-39

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

sp

6

275

S=373 I=31 E=8.33442e-37

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

sp

7

284

S=373 I=29 E=1.0009e-36

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

sp

7

284

S=373 I=28 E=1.05466e-36

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

sp

7

284

S=370 I=28 E=2.02814e-36

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

Iprscan IPR002220 [PR00146]

40

61

Dihydrodipicolinate synthetase

Iprscan IPR002220 [PR00146]

76

94

Dihydrodipicolinate synthetase

Iprscan IPR002220 [PR00146]

133

150

Dihydrodipicolinate synthetase

Iprscan IPR013785 [G3DSA:3.20.20.70]

7

294

Aldolase-type TIM barrel

Iprscan IPR002220 [PTHR12128]

1

296

Dihydrodipicolinate synthetase

Iprscan IPR002220 [PF00701]

8

293

Dihydrodipicolinate synthetase

PD543043

76

218

S=146 I=29 E=3.35353e-10

PDA1V576

196

221

S=130 I=100 E=2.64571e-08

PD485872

133

194

S=119 I=44 E=5.12806e-07

PD728475

76

134

S=106 I=37 E=2.2362e-05

PD001859

9

81

S=102 I=34 E=6.36635e-05

PDA1V5Y0

132

217

S=101 I=34 E=8.26963e-05

Iprscan [SSF51569]

6

294

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Dhekw4xx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

107 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr25690.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr25690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr25690.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr25690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
asd XFF4834R_chr27200
XFF4834R_chr_2870
XFF4834R_chr_2870
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27210
XFF4834R_chr27210
ID asd
AC XFF4834R_chr27200
LT XFF4834R_chr27200
OR XFF4834R_chr from 3135003 to 3136028 on strand -
DE probable aspartate-semialdehyde dehydrogenase
IP Aspartate-semialdehyde dehydrogenase, conserved site; Aspartate-semialdehyde dehydrogenase, bacterial; NAD(P)-binding domain
CL 1.5.1.7 Lysine, diaminopimelate GO:0009089
EC
GO InterPro
Biological Process: threonine biosynthetic process (GO:0009088)
Biological Process: methionine biosynthetic process (GO:0009086)
Biological Process: cellular amino acid biosynthetic process (GO:0008652)
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: cellular amino acid metabolic process (GO:0006520)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: aspartate-semialdehyde dehydrogenase activity (GO:0004073)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
Molecular Function: protein dimerization activity (GO:0046983)
Molecular Function: NAD or NADH binding (GO:0051287)
Molecular Function: NADP or NADPH binding (GO:0050661)
NAD or NADP as acceptor (GO:0016620)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: acur
CC STATUS: curated by darrasse (20110302)
MW 36585.9 Da
SQ 341 aa
 
........10........20........30........40........50
| | | | |
MSNENRRFNVAVVGATGAVGETMLSILAERNFPVATLYALASSRSAGGQV
EFNGGKVDVQDLAEFDPAGVDIALFSAGGSVSKEYGPKFAAAGAVVIDNS
SAFRYDDDVPLVVSEVNPEALKQRPRGIVANPNCSTMQMLVALGPIHRTY
GIERINVATYQSVSGGGRSAMEELGKQTSELLSFQDIDPQRFPVQIAFNL
IPHIDDFQDNGYTKEEMKLVWETRKILGDDSIQVNPTAVRVPVFYGHSEA
VAIETRDKITVEAARALLAASPGVEVVDERAPGGYPTPVTHASGKDAVFV
GRIREDFSHPRGLNLWIVSDNIRKGAALNAVQLAELVAQEG
pubmed

5

340

S=1093 I=61 E=1.04484e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

pubmed

5

340

S=1091 I=61 E=1.5334e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

pubmed

5

340

S=1090 I=61 E=2.21151e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

pubmed

5

340

S=1090 I=61 E=2.21151e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

pubmed

5

340

S=1090 I=61 E=2.21151e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

pubmed

5

340

S=1090 I=61 E=2.21151e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

pubmed

5

340

S=1090 I=61 E=2.21151e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

pubmed

5

340

S=1090 I=61 E=2.21151e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

pubmed

5

340

S=1090 I=61 E=2.21151e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

pubmed

5

340

S=1090 I=61 E=2.21151e-123

Aspartate-semialdehyde dehydrogenase

Pubmed 15003709

 

prodomImg

sp

5

340

S=1061 I=60 E=4.67771e-120

Aspartate-semialdehyde dehydrogenase EC=1.2.1.11 ; Amino-acid biosynthesis Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

sp

5

340

S=1009 I=57 E=8.49428e-114

Aspartate-semialdehyde dehydrogenase EC=1.2.1.11 ; Amino-acid biosynthesis Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

sp

5

340

S=1006 I=56 E=2.1404e-113

Aspartate-semialdehyde dehydrogenase EC=1.2.1.11 ; Amino-acid biosynthesis Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

sp

5

340

S=961 I=57 E=5.96335e-108

Aspartate-semialdehyde dehydrogenase EC=1.2.1.11 ; Amino-acid biosynthesis Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

sp

22

341

S=897 I=55 E=3.4201e-100

Aspartate-semialdehyde dehydrogenase EC=1.2.1.11 ; Amino-acid biosynthesis Diaminopimelate Lysine NADP Oxidoreductase

 

prodomImg

Iprscan [G3DSA:3.30.360.10]

133

338

-

Iprscan IPR012080 [PIRSF000148]

4

341

Aspartate-semialdehyde dehydrogenase

Iprscan [PTHR10174:SF2]

1

341

-

Iprscan [PTHR10174]

1

341

-

Iprscan IPR012280 [PF02774]

143

324

Semialdehyde dehydrogenase, dimerisation domain

Iprscan IPR000534 [PF01118]

9

123

Semialdehyde dehydrogenase, NAD-binding

Iprscan IPR000534 [SM00859]

9

124

Semialdehyde dehydrogenase, NAD-binding

Iprscan IPR005986 [TIGR01296]

9

340

Aspartate-semialdehyde dehydrogenase, bacterial

Iprscan [seg]

10

20

-

PD618127

250

340

S=289 I=62 E=1.28233e-27

PD002095

123

189

S=220 I=57 E=3.35274e-19

PDA1F6R6

188

249

S=207 I=69 E=1.27166e-17

PDA9K630

128

331

S=161 I=28 E=5.10975e-12

PD131454

21

341

S=125 I=25 E=1.25014e-07

PDA40391

92

182

S=120 I=29 E=4.6636e-07

PD274058

31

91

S=110 I=49 E=6.95886e-06

PD001262

90

117

S=107 I=82 E=1.7232e-05

Iprscan [SSF55347]

133

325

-

Iprscan IPR016040 [SSF51735]

8

148

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FBO7kleJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

96 hits
swiss-prot

Swiss-Prot ncbi-blastp

50 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr27200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr27200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr27200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr27200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
dapA1 XFF4834R_chr27520
XFF4834R_chr27510
XFF4834R_chr27510
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27530
XFF4834R_chr27530
ID dapA1
AC XFF4834R_chr27520
LT XFF4834R_chr27520
OR XFF4834R_chr from 3182099 to 3183007 on strand -
DE dihydrodipicolinate synthase
IP Dihydrodipicolinate synthetase; Dihydrodipicolinate synthase subfamily; Aldolase-type TIM barrel
CL 1.5.1.7 Lysine, diaminopimelate GO:0009089
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: diaminopimelate biosynthetic process (GO:0019877)
Molecular Function: dihydrodipicolinate synthase activity (GO:0008840)
Molecular Function: lyase activity (GO:0016829)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [EM] Amino acid transport and metabolism;Cell wall/membrane/envelope biogenesis;
CC MODEL: acur
CC STATUS: curated by darrasse (20110304)
MW 31103.1 Da
SQ 302 aa
 
........10........20........30........40........50
| | | | |
MSLSGIITALATPFGPDGALDLDAWRRLLEQQLHGGVQGLVVAGSTGEAA
ALSDDEYDTLLRAAVAQVAGRVPVLAGTGLSGTAKTIAHTRRAAALGAQY
ALVVTPPYVRPTQAGLKAHFLAVAEEGGLPVVLYNVPGRTGCDLLPETVA
ELVGHPNIVGIKEARSEPERIAALVVLRSDSFVVLSGDDGSAARAMLSGA
AGLISVASNALPAAYRRLCDLARDGQRDAAAAWDARLSEYHSFCGIESNP
IPVKALLQRAGIGHGLRLPLLPLSAAHQPAADRLAADAIALEALSSREML
AA
XFF4834R

XFF4834R_chr25690 lcl|XFF4834R_chr28250363_2980271_r2_XFF4834R-XFF4834R_chr25690

5

230

S=292 I=37 E=5.58255e-29

XFF4834R

XFF4834R_chr12530 lcl|XFF4834R_chr13180571_1419488_f3_XFF4834R-XFF4834R_chr12530

4

187

S=176 I=33 E=6.62631e-15

XFF4834R

XFF4834R_chr25690 lcl|XFF4834R_chr28250363_2980271_r2_XFF4834R-XFF4834R_chr25690

5

230

S=292 I=37 E=5.58255e-29

XFF4834R

XFF4834R_chr12530 lcl|XFF4834R_chr13180571_1419488_f3_XFF4834R-XFF4834R_chr12530

4

187

S=176 I=33 E=6.62631e-15

pubmed

3

274

S=548 I=45 E=9.47793e-58

Dihydrodipicolinate synthase ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 15277749

 

prodomImg

pubmed

3

274

S=538 I=45 E=1.27377e-56

Dihydrodipicolinate synthase ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 11425723

 

prodomImg

pubmed

3

274

S=529 I=47 E=1.61052e-55

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 19077236

 

prodomImg

pubmed

3

274

S=516 I=41 E=6.84167e-54

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 3514578

 

prodomImg

pubmed

3

274

S=512 I=42 E=1.93088e-53

Dihydrodipicolinate synthetas ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 16113328

 

prodomImg

pubmed

3

274

S=501 I=40 E=4.45552e-52

Dihydrodipicolinate synthetase ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 3514578

 

prodomImg

pubmed

1

274

S=495 I=39 E=2.548e-51

Dihydrodipicolinate synthase ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 19060158

 

prodomImg

pubmed

2

274

S=478 I=40 E=2.31112e-49

Dihydrodipicolinate synthase EC=4.2.1.52 ; Lyase

Pubmed 16329940

 

prodomImg

pubmed

1

274

S=469 I=39 E=2.87159e-48

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 8098035

 

prodomImg

pubmed

3

270

S=460 I=33 E=3.72696e-47

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

Pubmed 17038625

 

prodomImg

sp

1

302

S=1321 I=91 E=1.44372e-151

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

sp

1

302

S=1293 I=84 E=3.12891e-148

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

sp

1

302

S=1008 I=69 E=1.15451e-113

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

sp

1

302

S=1007 I=69 E=1.43569e-113

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

sp

1

274

S=955 I=72 E=3.02359e-107

Dihydrodipicolinate synthase EC=4.2.1.52 ; Amino-acid biosynthesis Cytoplasm Diaminopimelate Lyase Lysine Schiff base

 

prodomImg

Iprscan IPR002220 [PR00146]

36

57

Dihydrodipicolinate synthetase

Iprscan IPR002220 [PR00146]

72

90

Dihydrodipicolinate synthetase

Iprscan IPR002220 [PR00146]

104

120

Dihydrodipicolinate synthetase

Iprscan IPR002220 [PR00146]

129

146

Dihydrodipicolinate synthetase

Iprscan IPR013785 [G3DSA:3.20.20.70]

3

291

Aldolase-type TIM barrel

Iprscan IPR002220 [PTHR12128]

1

302

Dihydrodipicolinate synthetase

Iprscan IPR002220 [PF00701]

3

285

Dihydrodipicolinate synthetase

Iprscan IPR005263 [TIGR00674]

5

288

Dihydrodipicolinate synthase subfamily

Iprscan [seg]

275

294

-

PD485872

129

190

S=177 I=58 E=5.11335e-14

PD001859

5

79

S=146 I=45 E=3.07353e-10

PD728475

72

130

S=121 I=47 E=3.77943e-07

PD543043

72

163

S=114 I=40 E=2.08728e-06

PDA874B8

191

217

S=114 I=96 E=2.25766e-06

PDA0D1T3

36

214

S=111 I=27 E=5.25957e-06

PDA8I6N7

127

274

S=103 I=31 E=5.34762e-05

Iprscan [SSF51569]

2

288

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one oxuYLMcl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

104 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr27520.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr27520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr27520.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBsMc0TN/XFF4834R_chr27520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.