Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr30230wbqGXFF4834R_chr30230probable asparagine synthase
  2. XFF4834R_chr30630asnBXFF4834R_chr30630asparagine synthetase B

wbqG XFF4834R_chr30230
XFF4834R_chr30220
XFF4834R_chr30220
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr30240
XFF4834R_chr30240
ID wbqG
AC XFF4834R_chr30230
LT XFF4834R_chr30230
OR XFF4834R_chr from 3473828 to 3475768 on strand -
DE probable asparagine synthase
IP Asparagine synthase, glutamine-hydrolyzing; Rossmann-like alpha/beta/alpha sandwich fold
CL 1.5.1.6 Asparagine GO:0006529
EC
GO InterPro
Biological Process: asparagine biosynthetic process (GO:0006529)
Molecular Function: asparagine synthase (glutamine-hydrolyzing) activity (GO:0004066)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130521)
MW 70509.6 Da
SQ 646 aa
 
........10........20........30........40........50
| | | | |
MCGLAGMLLASPRLHGEQLDALVRPMGAALRHRGPDDAGTWCDAQAGVAL
AHQRLSILDLSPLGHQPMRSADGRYVLAYNGEVYNFAQLRAALSALGHRF
RGHSDTEVLLAAVVEWGLDETLTRCNGMFAIALWDERDNCLSLARDRVGK
KPLYYGWAGDTLVFGSELKALWQHPDFDNGVDRDALTLLLRLGYIPAPAC
IHEHTFKLMPGRVLRIDAQAVAAGAAAHRPDQAQLPFWNAREAMQRALAT
PFTGTDAQAEDQLDSVLRDAVALRMVADVPVGVFLSGGTDSSIVTAMMQA
QSAQPVHTFSIGFEGSHHDEAPLAREVATHLHTDHTELYVSGADALAVVP
GLPSMFDEPFADASQVPTALVARLARGGVTVALSGDGGDELFFGYGRYQR
ALRNWRMHGLVPGPLRRLMAVAARRNGESSRTGGLAALVAEAGARGIGDI
YRNRISRWRDPAAVVLGATEPDSFYSLADPLHGSGTPADAMMLADFAAYL
PDDLLCKVDRTTMAVGLEARAPLLDWRVAEFAWSLPLSLKYRDGVSKYLL
KRVLCRYLPDAMVYRGKRGFGAPVSAWLRGDLHGWADDLLAHGALQREGV
FAADTVAGLWRDFNGGERKWHTHLWTVLMFQAWQAHWRQQRAAVVR
XFF4834R

XFF4834R_chr_3174 lcl|XFF4834R_chr32660472_3454990_f2_XFF4834R-XFF4834R_chr_3174

495

630

S=377 I=52 E=7.03712e-39

XFF4834R

XFF4834R_chr30630 lcl|asnB-XFF4834R_chr30630

1

171

S=253 I=41 E=7.51681e-24

asparagine synthetase B

XFF4834R

XFF4834R_chr30630 lcl|asnB-XFF4834R_chr30630

262

408

S=115 I=31 E=4.13211e-07

asparagine synthetase B

XFF4834R

XFF4834R_chr_3174 lcl|XFF4834R_chr32660472_3454990_f2_XFF4834R-XFF4834R_chr_3174

495

630

S=377 I=52 E=7.03712e-39

XFF4834R

XFF4834R_chr30630 lcl|asnB-XFF4834R_chr30630

1

171

S=253 I=41 E=7.51681e-24

asparagine synthetase B

XFF4834R

XFF4834R_chr30630 lcl|asnB-XFF4834R_chr30630

262

408

S=115 I=31 E=4.13211e-07

asparagine synthetase B

pubmed

1

630

S=1371 I=44 E=4.56677e-157

Putative asparagine synthase

Pubmed 12843098

 

prodomImg

pubmed

1

630

S=1371 I=44 E=4.56677e-157

WbpS

Pubmed 14687563

 

prodomImg

pubmed

1

630

S=1356 I=46 E=2.97403e-155

Similar to Asparagine synthase WbpS

Pubmed 10627048

 

prodomImg

pubmed

1

630

S=1355 I=46 E=3.36013e-155

Asparagine synthase-like protein Lipopolysaccharide B-band O-antigen biosynthesis protein

Pubmed 12562802

 

prodomImg

pubmed

1

630

S=1338 I=47 E=4.6316e-153

Putative asparagine synthetase

Pubmed 11557147,12595458

 

prodomImg

pubmed

1

630

S=1333 I=47 E=1.77359e-152

Putative asparagine synthetase

Pubmed 15183868

 

prodomImg

pubmed

1

630

S=1317 I=48 E=1.38709e-150

Putative asparagine synthetase

Pubmed 15183868

 

prodomImg

pubmed

1

630

S=1309 I=44 E=1.51219e-149

ORF71x8 protein

Pubmed 9098074

 

prodomImg

pubmed

1

630

S=1306 I=44 E=3.55374e-149

WbfR protein

Pubmed 10521656

 

prodomImg

pubmed

1

630

S=1297 I=44 E=3.97692e-148

Putative uncharacterized protein ; Transferase

Pubmed 8820651

 

prodomImg

sp_Pdown

sp|P54420|ASNB_BACSU

1

630

S=757 I=31 E=7.06715e-83

Asparagine synthetase [glutamine-hydrolyzing] 1 EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

sp_Pdown

sp|P64247|ASNH_MYCTU

30

630

S=668 I=35 E=4.15016e-72

Putative asparagine synthetase [glutamine-hydrolyzing] EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

sp_Pdown

sp|P64248|ASNH_MYCBO

30

630

S=668 I=35 E=4.15016e-72

Putative asparagine synthetase [glutamine-hydrolyzing] EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

sp_Pdown

sp|Q58456|ASNH2_METJA

1

424

S=613 I=34 E=1.98363e-65

Putative asparagine synthetase [glutamine-hydrolyzing] 2 EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

sp_Pdown

sp|O05272|ASNO_BACSU

1

401

S=473 I=33 E=1.62846e-48

Asparagine synthetase [glutamine-hydrolyzing] 3 EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding Sporul

Iprscan [G3DSA:3.60.20.10]

2

199

-

Iprscan IPR014729 [G3DSA:3.40.50.620]

245

603

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [PTHR11772]

76

590

-

Iprscan IPR001962 [PF00733]

263

567

Asparagine synthase

Iprscan IPR006426 [TIGR01536]

2

570

Asparagine synthase, glutamine-hydrolyzing

Iprscan [seg]

218

227

-

Iprscan [seg]

433

446

-

Iprscan [seg]

631

643

-

Iprscan [SignalP-NN(euk)]

1

16

-

PD001586

497

570

S=171 I=44 E=4.72566e-13

PD008420

237

306

S=170 I=51 E=5.24688e-13

PD287006

472

502

S=156 I=100 E=2.63052e-11

PDA1S5T8

307

334

S=146 I=100 E=4.63236e-10

PD035904

573

630

S=143 I=48 E=9.38661e-10

PD404026

26

73

S=141 I=58 E=1.93548e-09

PDA9G3L5

33

153

S=133 I=31 E=1.59633e-08

PD000635

76

146

S=131 I=40 E=2.62394e-08

PDA99237

267

400

S=131 I=34 E=3.29157e-08

PDA3C8D7

55

216

S=130 I=29 E=3.40839e-08

Iprscan [SSF52402]

247

630

-

Iprscan [SSF56235]

1

231

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jmJGrrht)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

135 hits
swiss-prot

Swiss-Prot ncbi-blastp

54 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNQiLI6/XFF4834R_chr30230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNQiLI6/XFF4834R_chr30230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNQiLI6/XFF4834R_chr30230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNQiLI6/XFF4834R_chr30230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
asnB XFF4834R_chr30630
XFF4834R_chr30620
XFF4834R_chr30620
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3239
XFF4834R_chr_3239
ID asnB
AC XFF4834R_chr30630
LT XFF4834R_chr30630
OR XFF4834R_chr from 3523379 to 3525073 on strand -
DE asparagine synthetase B
IP Asparagine synthase, glutamine-hydrolyzing; Rossmann-like alpha/beta/alpha sandwich fold
CL 1.5.1.6 Asparagine GO:0006529
EC
GO InterPro
Biological Process: asparagine biosynthetic process (GO:0006529)
Molecular Function: asparagine synthase (glutamine-hydrolyzing) activity (GO:0004066)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: acur
CC STATUS: curated by koebnik (20101112)
MW 62557 Da
SQ 564 aa
 
........10........20........30........40........50
| | | | |
MCSIFGIFGLQPGDDLQALRRQALECSQRQRHRGPDWSGVYVDTGAILVH
ERLAIVDPAGGSQPLLSEDGQLALAVNGEIYNHRELKAELLQPYAFQTGS
DCEVINALYREDTPASYLNRLNGIFAFALWDKTEGRVIIARDPIGVVPLY
WGHDREGRLRVASELKSLVDDCADAAQFPPGHWYDSATGALNRYYERAWR
QYGAVEGVQVQLQELREAFERAVHRQLMTDVPYGVLLSGGLDSSLVAAVA
ARYARHRIEENDTTEAWWPRLHSFAIGLKGSPDLAAAEVAAAALGTVHHG
FEYTFDEGLDALPDVIRHIETYDVTTIRASTPMFLLARRIKAMGVKMVLS
GEGSDEIFGGYLYFHKAPNAREFHEELVRKLDALNNYDCLRANKSMMAWG
VEPRVPFLDREFLDVAMRMDARFKMIDKTSSGATRMEKGVLREAFAGYLP
ESILWRQKEQFSDGVGYGWIDGLKAHAQAQVSDRELAAADRRYPVNPPQT
KEAYFYRSLFEQFFPGQAAAETVPGGKSIACSSPTAIAWDASFAAMADPS
GRAIAGVHAQALAS
XFF4834R

XFF4834R_chr30230 lcl|XFF4834R_chr32830828_3475768_r3_XFF4834R-XFF4834R_chr30230

1

168

S=254 I=41 E=5.44286e-24

XFF4834R

XFF4834R_chr30230 lcl|XFF4834R_chr32830828_3475768_r3_XFF4834R-XFF4834R_chr30230

1

168

S=254 I=41 E=5.44286e-24

pubmed

1

561

S=1642 I=57 E=0

Asparagine synthetase B [glutamine-hydrolyzing] EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

Pubmed 1973930

 

prodomImg

pubmed

1

559

S=1480 I=53 E=2.40308e-170

Asparagine synthetase

Pubmed 9881155

 

prodomImg

pubmed

1

561

S=1476 I=53 E=7.08427e-170

Asparagine synthetase

Pubmed 9881155

 

prodomImg

pubmed

1

561

S=1475 I=52 E=8.80963e-170

Asparagine synthetase

Pubmed 18507865

 

prodomImg

pubmed

1

564

S=1472 I=52 E=2.08844e-169

Asparagine synthetase EC=6.3.5.4 ; Ligase

Pubmed 9501527

 

prodomImg

pubmed

1

561

S=1467 I=51 E=7.32957e-169

Asparagine synthetase [glutamine-hydrolyzing] EC=6.3.5.4 ; Alternative splicing Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucle

Pubmed 7846154

 

prodomImg

pubmed

1

561

S=1462 I=52 E=3.52086e-168

Asparagine synthetase [glutamine-hydrolyzing] EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

Pubmed 9831643

 

prodomImg

pubmed

1

561

S=1459 I=52 E=6.95019e-168

Asparagine synthetase [glutamine-hydrolyzing] EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

Pubmed 7904077

 

prodomImg

pubmed

1

561

S=1459 I=51 E=8.20238e-168

Asparagine synthetase [glutamine-hydrolyzing] 2 EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

Pubmed 8639748

 

prodomImg

pubmed

1

561

S=1451 I=51 E=7.25381e-167

Glutamine-dependent asparagine synthetase EC=6.3.5.4 ; Ligase

Pubmed 15700423

 

prodomImg

sp_Pdown

sp|P22106|ASNB_ECOLI

1

561

S=1642 I=57 E=0

Asparagine synthetase B [glutamine-hydrolyzing] EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

sp_Pdown

sp|Q43011|ASNS_ORYSJ

1

561

S=1487 I=53 E=2.14966e-171

Asparagine synthetase [glutamine-hydrolyzing] EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

sp_Pdown

sp|P49078|ASNS_ARATH

1

561

S=1467 I=51 E=5.04338e-169

Asparagine synthetase [glutamine-hydrolyzing] EC=6.3.5.4 ; Alternative splicing Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucle

sp_Pdown

sp|O24661|ASNS_TRIVS

1

561

S=1462 I=52 E=2.42266e-168

Asparagine synthetase [glutamine-hydrolyzing] EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

sp_Pdown

sp|P31752|ASNS_ASPOF

1

561

S=1459 I=52 E=4.78233e-168

Asparagine synthetase [glutamine-hydrolyzing] EC=6.3.5.4 ; Amino-acid biosynthesis ATP-binding amidotransferase Ligase Nucleotide-binding

Iprscan [coil]

205

226

-

Iprscan [G3DSA:3.60.20.10]

2

196

-

Iprscan IPR014729 [G3DSA:3.40.50.620]

197

525

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [PTHR11772]

73

562

-

Iprscan IPR001962 [PF00733]

214

458

Asparagine synthase

Iprscan IPR006426 [TIGR01536]

2

461

Asparagine synthase, glutamine-hydrolyzing

Iprscan [seg]

234

255

-

Iprscan [seg]

285

293

-

PD001586

363

462

S=247 I=54 E=2.06071e-22

PDA141W1

144

232

S=226 I=49 E=7.87794e-20

PD002653

463

515

S=204 I=66 E=3.58541e-17

PD035910

296

365

S=189 I=51 E=2.06664e-15

PDA3X833

303

361

S=181 I=57 E=2.23347e-14

PD003896

518

558

S=156 I=68 E=2.40974e-11

PDA1L133

1

29

S=148 I=90 E=2.24551e-10

PD892748

1

65

S=135 I=49 E=9.1323e-09

PD000635

72

142

S=121 I=41 E=3.87952e-07

PD953310

1

71

S=121 I=44 E=3.94776e-07

Iprscan [SSF52402]

197

525

-

Iprscan [SSF56235]

2

195

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wjg0MLqf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

89 hits
swiss-prot

Swiss-Prot ncbi-blastp

39 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNQiLI6/XFF4834R_chr30630.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNQiLI6/XFF4834R_chr30630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNQiLI6/XFF4834R_chr30630.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNQiLI6/XFF4834R_chr30630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.