Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr17130proCXFF4834R_chr17130pyrroline-5-carboxylate reductase
  2. XFF4834R_chr23470proAXFF4834R_chr23470gamma-glutamylphosphate reductase
  3. XFF4834R_chr23480proBXFF4834R_chr23480gamma-glutamate kinase

proC XFF4834R_chr17130
XFF4834R_chr17120
XFF4834R_chr17120
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17140
XFF4834R_chr17140
ID proC
AC XFF4834R_chr17130
LT XFF4834R_chr17130
OR XFF4834R_chr from 1961811 to 1962665 on strand -
DE pyrroline-5-carboxylate reductase
IP Delta 1-pyrroline-5-carboxylate reductase
CL 1.5.1.4 Proline GO:0006561
EC
GO InterPro
Biological Process: proline biosynthetic process (GO:0006561)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: pyrroline-5-carboxylate reductase activity (GO:0004735)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110310)
MW 28868.5 Da
SQ 284 aa
 
........10........20........30........40........50
| | | | |
MNTPASSSPSSSATTSIAFVGGGNMARSLIAGLIRQGAPAASIRVAEPVA
DLREALARDFGVQVVEDARAAVDAATTWVLAVKPQILPMVCTQLADLAQA
QQPLLVSIAAGITATQLQRWSGGDIAVVRAMPNTPALLGAGVTGLYANAR
VSATQRQQATQLLGSAGVTVWIDDEAQMDAVTAVSGSGPAYVFLLAEAME
AAAQAQGLPAATARTLVLQTLLGAARMLTESGEPPEVLRRRVTSPNGTTH
AAIETFQAGGFEALTAQAIAAATERGRSLSAANG
XFF4834R

YP_364801.1 lcl|proC-XCV3070

17

283

S=950 I=74 E=4.32156e-108

pyrroline-5-carboxylate reductase

XFF4834R

NP_643235.1 lcl|proC-XAC2926

17

283

S=949 I=75 E=5.56479e-108

pyrroline-5-carboxylate reductase

XFF4834R

NP_638105.1 lcl|proC-XCC2757

17

283

S=851 I=67 E=3.75397e-96

pyrroline-5-carboxylate reductase

XFF4834R

lcl|proC-XALc_2163

17

262

S=709 I=62 E=7.43439e-79

probable pyrroline-5-carboxylate reductase (p5cr) protein

pubmed

17

280

S=542 I=47 E=3.84146e-57

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 2107123

 

prodomImg

pubmed

17

280

S=376 I=36 E=5.08141e-37

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Oxidoreductase

Pubmed 12446909

 

prodomImg

pubmed

17

256

S=338 I=34 E=1.95633e-32

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 8982386

 

prodomImg

pubmed

17

261

S=337 I=34 E=2.51913e-32

Delta-1-pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Oxidoreductase

Pubmed 11929217

 

prodomImg

pubmed

17

280

S=305 I=32 E=1.9498e-28

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 2199815

 

prodomImg

pubmed

108

261

S=302 I=45 E=5.40769e-28

HI0307-like protein

Pubmed 16714566

 

prodomImg

pubmed

17

280

S=291 I=32 E=1.17395e-26

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 6296787

 

prodomImg

pubmed

17

260

S=290 I=32 E=1.24783e-26

Pyrroline-5-carboxylate reductase 1 EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 10568751

 

prodomImg

pubmed

17

280

S=289 I=31 E=1.8313e-26

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Alternative splicing Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 8022935

 

prodomImg

pubmed

17

280

S=288 I=31 E=2.37878e-26

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 11537868

 

prodomImg

sp_Pdown

sp|P22008|P5CR_PSEAE

17

280

S=542 I=47 E=2.64898e-57

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

sp_Pdown

sp|P43869|P5CR_HAEIN

17

261

S=412 I=40 E=1.69025e-41

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

sp_Pdown

sp|Q9CPE8|P5CR_PASMU

17

252

S=362 I=38 E=1.69653e-35

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

sp_Pdown

sp|P52053|P5CR_VIBAL

17

256

S=338 I=34 E=1.34904e-32

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

sp_Pdown

sp|P17817|P5CR_SOYBN

17

280

S=305 I=32 E=1.34454e-28

Pyrroline-5-carboxylate reductase EC=1.5.1.2 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Iprscan IPR000304 [PIRSF000193]

14

282

Delta 1-pyrroline-5-carboxylate reductase

Iprscan IPR004455 [PF03807]

16

264

NADP oxidoreductase, coenzyme F420-dependent

Iprscan IPR000304 [TIGR00112]

17

279

Delta 1-pyrroline-5-carboxylate reductase

Iprscan IPR000304 [PS00521]

234

257

Delta 1-pyrroline-5-carboxylate reductase

Iprscan [seg]

3

16

-

Iprscan [seg]

62

79

-

Iprscan [seg]

93

105

-

Iprscan [seg]

194

213

-

Iprscan [seg]

263

272

-

PD002555

181

261

S=163 I=46 E=3.09012e-12

PD994109

106

179

S=131 I=43 E=2.04437e-08

PDA86292

131

183

S=114 I=45 E=2.30592e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RbGxjua6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

36 hits
swiss-prot

Swiss-Prot ncbi-blastp

51 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr17130.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr17130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr17130.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr17130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
proA XFF4834R_chr23470
XFF4834R_chr23460
XFF4834R_chr23460
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23480
XFF4834R_chr23480
ID proA
AC XFF4834R_chr23470
LT XFF4834R_chr23470
OR XFF4834R_chr from 2717560 to 2718804 on strand -
DE gamma-glutamylphosphate reductase
IP Gamma-glutamyl phosphate reductase GPR; Glutamate-5-semialdehyde dehydrogenase; Aldehyde dehydrogenase, N-terminal; Aldehyde dehydrogenase, C-terminal; Gamma-glutamyl phosphate reductase GPR, conserved site
CL 1.5.1.4 Proline GO:0006561
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Biological Process: proline biosynthetic process (GO:0006561)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: glutamate-5-semialdehyde dehydrogenase activity (GO:0004350)
Molecular Function: NADP or NADPH binding (GO:0050661)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 44173.3 Da
SQ 414 aa
 
........10........20........30........40........50
| | | | |
MTIKTLALQCRDAAQVVSQLSAQAKHALLDAMAAALEADAAAILAANARD
LEAARAKGTGSAMLDRLALDDKRLAGIATALREVAQLPDPVGLITREEVR
PNGIRVQKVRVPLGVIAMIYEARPNVTADAAALCIKAGNGVILRGGSEAI
HSNTAIARALQRALRKANVPEAALTLVEDLRRETMLELLQLSDIVDLAIP
RGGEGLIRFVAEHARVPVIKHYKGVCHLFVDASADLTLALRLLIDGKATR
PAACNSLETLLVHADIAERFLPLAAQALCERKVELRGDAATRAVLPEIAP
ADDDDYAAEFLDLILAIRVVPDLDTALAHIRQYGSDHTEVIATQDADNAE
RFVQALRSAVVMVNASSRFSDGGELGLGAEIGISTTRLHSYGPMGLEALT
VERFVVRGQGQVRH
Hamap PROA_MF_00412 raw_score=11110 norm_score=44.244

Gamma-glutamyl phosphate reductase [proA].

XFF4834R

NP_642658.1 lcl|proA-XAC2342

1

414

S=1567 I=81 E=0

gamma-glutamyl phosphate reductase

XFF4834R

YP_364272.1 lcl|proA-XCV2541

1

414

S=1561 I=79 E=0

gamma-glutamyl phosphate reductase

XFF4834R

NP_637593.1 lcl|proA-XCC2238

1

414

S=1476 I=76 E=1.14232e-171

gamma-glutamyl phosphate reductase

XFF4834R

lcl|proA-XALc_1886

2

414

S=1395 I=71 E=9.03051e-162

probable gamma-glutamyl phosphate reductase (gpr) (glutamate-5-semialdehyde dehydrogenase) (glutamyl-gamma-semialdehyde dehydrogenase) (gsa dehydrogenase) protein

pubmed

77

413

S=915 I=55 E=4.11011e-102

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 17965706

 

prodomImg

pubmed

77

413

S=878 I=49 E=1.21819e-97

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 18441057

 

prodomImg

pubmed

77

413

S=830 I=49 E=8.11635e-92

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis NADP Oxidoreductase Proline

Pubmed 7988899

 

prodomImg

pubmed

57

414

S=819 I=45 E=1.65765e-90

Gamma-glutamyl phosphate reductase (GPR) EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 12446909

 

prodomImg

pubmed

57

414

S=794 I=42 E=2.07421e-87

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 11375165

 

prodomImg

pubmed

77

413

S=786 I=45 E=1.88295e-86

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 2984205

 

prodomImg

pubmed

77

413

S=783 I=43 E=4.42503e-86

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 19014707

 

prodomImg

pubmed

76

414

S=779 I=44 E=1.24885e-85

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 8969524

 

prodomImg

pubmed

77

413

S=754 I=45 E=1.25663e-82

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 18192381

 

prodomImg

pubmed

77

413

S=740 I=43 E=7.90312e-81

Glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Pubmed 12693104

 

prodomImg

sp_Pdown

sp|Q5GZF2|PROA_XANOR

1

414

S=1619 I=79 E=0

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

sp_Pdown

sp|B2SHW6|PROA_XANOP

1

414

S=1614 I=79 E=0

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

sp_Pdown

sp|Q2P2G1|PROA_XANOM

1

414

S=1614 I=79 E=0

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

sp_Pdown

sp|B0RS59|PROA_XANCB

1

414

S=1569 I=77 E=0

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

sp_Pdown

sp|Q8PK35|PROA_XANAC

1

414

S=1567 I=81 E=0

Gamma-glutamyl phosphate reductase EC=1.2.1.41 ; Amino-acid biosynthesis Cytoplasm NADP Oxidoreductase Proline

Iprscan IPR016162 [G3DSA:3.40.605.10]

1

218

Aldehyde dehydrogenase, N-terminal

Iprscan IPR016163 [G3DSA:3.40.309.10]

219

394

Aldehyde dehydrogenase, C-terminal

Iprscan IPR012134 [MF_00412]

2

414

Glutamate-5-semialdehyde dehydrogenase

Iprscan IPR012134 [PIRSF000151]

1

414

Glutamate-5-semialdehyde dehydrogenase

Iprscan IPR000965 [TIGR00407]

10

403

Gamma-glutamyl phosphate reductase GPR

Iprscan IPR020593 [PS01223]

320

341

Gamma-glutamyl phosphate reductase GPR, conserved site

Iprscan [seg]

13

56

-

Iprscan [seg]

64

75

-

Iprscan [seg]

372

383

-

PD403271

250

354

S=308 I=53 E=8.8028e-30

PD813400

76

149

S=265 I=65 E=1.3556e-24

PDA1E4Y5

152

247

S=248 I=47 E=1.47663e-22

PDA1D4M4

145

364

S=130 I=26 E=2.83119e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1u5WFOqv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr23470.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr23470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr23470.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr23470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
proB XFF4834R_chr23480
XFF4834R_chr23470
XFF4834R_chr23470
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23490
XFF4834R_chr23490
ID proB
AC XFF4834R_chr23480
LT XFF4834R_chr23480
OR XFF4834R_chr from 2718964 to 2720118 on strand -
DE gamma-glutamate kinase
IP Delta l-pyrroline-5-carboxylate synthetase; Glutamate 5-kinase, pro-B; Glutamate 5-kinase, conserved site
CL 1.5.1.4 Proline GO:0006561
EC
GO InterPro
Biological Process: proline biosynthetic process (GO:0006561)
Biological Process: cellular amino acid biosynthetic process (GO:0008652)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: RNA binding (GO:0003723)
Molecular Function: glutamate 5-kinase activity (GO:0004349)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 40594.8 Da
SQ 384 aa
 
........10........20........30........40........50
| | | | |
MSTPASTLSPFTEQALPPWRRAVLKVGSSLLAADGGGLSPRFALGLAQFV
SANLAAGRELVIVSSGAVAAGRAILPKAMDIGAPIAARQALAALGQAQLI
ALWQRFFERPVAQVLLTHDDLRNRRRYLNARATLGELLRLGALPVINEND
TVSVDELKLGDNDNLAAIVAALVDADALFIATDIDGLYSADPRSNPLARP
LDDVPELTPEVLAMAGGSGSNVGTGGMRTKLEAAAKAGAAGIETYLFNGR
SGEVVRALAQDRLRGTRIHAARTRIAARKYWLRHAPVEAGAILIDDGAAA
ALTGKGASLLPGGVADAHGDFRRGDMVEIRRRDTTGEQCLARGVSQYSAL
DIRRIAGRHSREIENVLGYSYGENVVHRDDLVLL
Show or not Domain decomposition
 
Hamap PROB_MF_00456 raw_score=5652 norm_score=34.804

Glutamate 5-kinase [proB].

XFF4834R

YP_364273.1 lcl|proB-XCV2542

1

384

S=1236 I=68 E=1.46167e-142

gamma-glutamyl kinase

XFF4834R

NP_642659.2 lcl|proB-XAC2343

1

384

S=1232 I=68 E=3.61947e-142

gamma-glutamyl kinase

XFF4834R

NP_637594.2 lcl|proB-XCC2239

1

384

S=1090 I=61 E=6.18057e-125

gamma-glutamyl kinase

XFF4834R

lcl|proB-XALc_1887

1

383

S=1026 I=57 E=4.07532e-117

probable glutamate 5-kinase (gamma-glutamyl kinase) (gk) protein

pubmed

46

383

S=332 I=35 E=1.98911e-31

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

Pubmed 7988899

 

prodomImg

pubmed

55

383

S=329 I=31 E=3.75902e-31

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

Pubmed 1851803,1316937

 

prodomImg

pubmed

55

382

S=327 I=31 E=6.80075e-31

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

Pubmed 6089111

 

prodomImg

pubmed

57

383

S=316 I=28 E=1.3297e-29

Glutamate 5-kinase ; ATP-binding Amino-acid biosynthesis Cytoplasm Nucleotide-binding Proline Transferase

Pubmed 18226230

 

prodomImg

pubmed

48

382

S=277 I=26 E=7.64526e-25

Glutamate 5-kinase 1 EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

Pubmed 8083159

 

prodomImg

pubmed

57

384

S=258 I=26 E=1.67283e-22

Glutamyl kinase EC=2.7.2.11 ; ATP-binding Amino-acid biosynthesis Cytoplasm Nucleotide-binding Proline Transferase

Pubmed 12693104

 

prodomImg

pubmed

58

384

S=257 I=30 E=1.90656e-22

Gamma-glutamyl kinase ; ATP-binding Amino-acid biosynthesis Cytoplasm Nucleotide-binding Proline Transferase

Pubmed 18310024

 

prodomImg

pubmed

57

384

S=255 I=26 E=3.76354e-22

Glutamyl kinase EC=2.7.2.11 ; ATP-binding Amino-acid biosynthesis Cytoplasm Nucleotide-binding Proline Transferase

Pubmed 12693104

 

prodomImg

pubmed

40

384

S=245 I=24 E=6.62761e-21

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

Pubmed 11844777

 

prodomImg

pubmed

103

372

S=236 I=31 E=8.09253e-20

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis Cytoplasm Proline Transferase

Pubmed 18700039

 

prodomImg

sp_Pdown

sp|Q8PK34|PROB_XANAC

23

384

S=1115 I=66 E=1.43175e-126

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

sp_Pdown

sp|Q3BSJ0|PROB_XANC5

23

384

S=1113 I=65 E=2.45828e-126

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

sp_Pdown

sp|Q5GZF1|PROB_XANOR

23

384

S=1082 I=64 E=1.80573e-122

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

sp_Pdown

sp|Q2P2G0|PROB_XANOM

23

384

S=1072 I=64 E=2.91439e-121

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

sp_Pdown

sp|Q8P8K2|PROB_XANCP

23

384

S=1009 I=61 E=1.23188e-113

Glutamate 5-kinase EC=2.7.2.11 ; Amino-acid biosynthesis ATP-binding Cytoplasm Nucleotide-binding Proline Transferase

Iprscan IPR001048 [G3DSA:3.40.1160.10]

13

270

Aspartate/glutamate/uridylate kinase

Iprscan [MF_00456]

19

273

-

Iprscan IPR011529 [PIRSF000729]

12

384

Glutamate 5-kinase, pro-B

Iprscan IPR001048 [PF00696]

20

248

Aspartate/glutamate/uridylate kinase

Iprscan IPR002478 [PF01472]

290

367

Pseudouridine synthase/archaeosine transglycosylase

Iprscan IPR002478 [SM00359]

290

376

Pseudouridine synthase/archaeosine transglycosylase

Iprscan IPR005715 [TIGR01027]

20

383

Glutamate 5-kinase, ProB-related

Iprscan IPR019797 [PS00902]

220

237

Glutamate 5-kinase, conserved site

Iprscan IPR002478 [PS50890]

289

370

Pseudouridine synthase/archaeosine transglycosylase

Iprscan [seg]

27

39

-

Iprscan [seg]

81

102

-

Iprscan [seg]

119

132

-

Iprscan [seg]

161

181

-

Iprscan [seg]

216

226

-

Iprscan [seg]

233

241

-

Iprscan [seg]

266

278

-

Iprscan [seg]

289

302

-

PD005319

279

384

S=222 I=44 E=2.12233e-19

PD102733

111

158

S=116 I=50 E=1.54729e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one YhlaSd6O)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

392 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

17 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr23480.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr23480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr23480.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBpmooiS/XFF4834R_chr23480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.