Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr23500argHXFF4834R_chr23500argininosuccinate lyase
  2. XFF4834R_chr23530argBXFF4834R_chr23530acetylglutamate kinase
  3. XFF4834R_chr23560argGXFF4834R_chr23560argininosuccinate synthetase
  4. XFF4834R_chr25270XFF4834R_chr27630390_2915886_f1_XFF4834R-XFF4834R_chr25270XFF4834R_chr25270putative ornithine/acetylornithine aminotransferase

argH XFF4834R_chr23500
XFF4834R_chr23490
XFF4834R_chr23490
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23510
XFF4834R_chr23510
ID argH
AC XFF4834R_chr23500
LT XFF4834R_chr23500
OR XFF4834R_chr from 2720389 to 2721687 on strand -
DE argininosuccinate lyase
IP Fumarate lyase; Argininosuccinate lyase; Fumarate lyase, conserved site
CL 1.5.1.3 Arginine GO:0006526
EC
GO InterPro
Biological Process: arginine biosynthetic process via ornithine (GO:0042450)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: argininosuccinate lyase activity (GO:0004056)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 46415.2 Da
SQ 432 aa
 
........10........20........30........40........50
| | | | |
MTNLLWQKPGVAVDAKIQSFLAGDDVILDREFFLYDIAASKAHAQGLQHI
GILSLQELGGLSEQLDLLAADFCSGAFVLDAQYEDCHSAIEARLTERLGD
AGRKIHTGRSRNDQILVATRLWLKDKLQRVATLSAEIAKVALERAQAEAE
LPVPGYTHIQRAVVSSAGMWWAGWAEAFIDNAVRADDTVRLVDSNPLGTA
AGYGVNLPLDRAHTTAELGFARLLVSPIYAQLSRGKYELAALEALGSATL
DLRRIAWDLSLFTSGEFAFVALPAQYTTGSSIMPNKRNPDVIELMRATHA
SVAAARTEIEQLLSLPSGYHRDLQSSKGAIVHGFGRGLAALELLPALLAN
LEWRPDKLRAAIDSGMYATDVAVEAAVAGVPFREAYKAAAQASETAGQGR
TPEGSLAARVSPGAAADLQLDVLQARWQALRA
Hamap ARLY_MF_00006 raw_score=6172 norm_score=29.371

Argininosuccinate lyase [argH].

XFF4834R

XFF4834R_chr03530 lcl|XFF4834R_chr03670131_0406513_f2_XFF4834R-XFF4834R_chr03530

89

289

S=102 I=31 E=1.1638e-05

XFF4834R

XFF4834R_chr29720 lcl|fumC-XFF4834R_chr29720

105

309

S=100 I=28 E=1.59291e-05

fumarate hydratase (fumarase C),aerobic Class II

XFF4834R

NP_642661.1 lcl|argH-XAC2345

1

432

S=2002 I=93 E=0

argininosuccinate lyase

XFF4834R

YP_364275.1 lcl|argH-XCV2544

1

432

S=1948 I=93 E=0

argininosuccinate lyase

XFF4834R

NP_637597.1 lcl|argH-XCC2242

1

431

S=1861 I=88 E=0

argininosuccinate lyase

XFF4834R

lcl|argH-XALc_1889

1

430

S=1779 I=82 E=0

probable argininosuccinate lyase (arginosuccinase) (asal) protein

XFF4834R

NP_636866.1 lcl|fumC-XCC1494

105

293

S=109 I=28 E=6.1031e-06

fumarate hydratase

XFF4834R

lcl|pcaB-XALc_3028

89

289

S=106 I=30 E=1.3851e-05

probable 3-carboxy-cis,cis-muconate cycloisomerase protein

XFF4834R

NP_640725.1 lcl|pcaB-XAC0369

89

289

S=104 I=31 E=2.48415e-05

3-carboxy-cis,cis-muconate cycloisomerase

XFF4834R

lcl|fumC-XALc_1664

105

309

S=100 I=27 E=5.94057e-05

probable fumarate hydratase class II (fumarase c) protein

XFF4834R

NP_641875.1 lcl|fumC-XAC1542

105

309

S=100 I=28 E=6.04507e-05

fumarate hydratase

XFF4834R

YP_363316.1 lcl|fumC-XCV1585

105

309

S=99 I=28 E=9.18657e-05

fumarate hydratase

pubmed

5

389

S=695 I=36 E=2.39091e-75

Argininosuccinate lyase ; Amino-acid biosynthesis Arginine

Pubmed 18048332

 

prodomImg

pubmed

1

391

S=688 I=37 E=1.30898e-74

Argininosuccinate lyase EC=4.3.2.1 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 10732680

 

prodomImg

pubmed

12

397

S=507 I=33 E=1.10811e-52

Argininosuccinate lyase EC=4.3.2.1 ; Amino-acid biosynthesis Arginine Disease mutation Polymorphism Urea cycle

Pubmed 3391281,3463959

 

prodomImg

pubmed

12

392

S=507 I=33 E=1.40222e-52

Argininosuccinate lyase EC=4.3.2.1 ; Amino-acid biosynthesis Arginine Polymorphism Urea cycle

Pubmed 2834354,2789519

 

prodomImg

pubmed

1

391

S=504 I=33 E=3.26669e-52

Argininosuccinate lyase EC=4.3.2.1 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 12446909

 

prodomImg

pubmed

28

396

S=501 I=35 E=6.67732e-52

Argininosuccinate lyase EC=4.3.2.1 ; Amino-acid biosynthesis Arginine Cytoplasm

Pubmed 11683360

 

prodomImg

pubmed

29

397

S=494 I=32 E=4.20295e-51

Argininosuccinate lyase EC=4.3.2.1 ; Amino-acid biosynthesis Arginine Eye lens protein

Pubmed 2269436,15966727

 

prodomImg

pubmed

28

396

S=492 I=33 E=9.13174e-51

Argininosuccinate lyase EC=4.3.2.1 ; Amino-acid biosynthesis Arginine

Pubmed 2583083,10071206

 

prodomImg

pubmed

29

397

S=490 I=32 E=1.6521e-50

Argininosuccinate lyase EC=4.3.2.1 ; Amino-acid biosynthesis Arginine Eye lens protein

Pubmed 3941090,4018032

 

prodomImg

pubmed

36

397

S=485 I=32 E=5.74786e-50

Argininosuccinate lyase EC=4.3.2.1 ; Amino-acid biosynthesis Arginine Eye lens protein

Pubmed 8484796,16101585

 

prodomImg

Iprscan [coil]

130

151

-

Iprscan [G3DSA:1.20.200.10]

122

392

-

Iprscan IPR009049 [MF_00006]

3

431

Argininosuccinate lyase

Iprscan IPR000362 [PF00206]

7

304

Fumarate lyase

Iprscan IPR009049 [TIGR00838]

5

428

Argininosuccinate lyase

Iprscan IPR020557 [PS00163]

279

288

Fumarate lyase, conserved site

Iprscan [seg]

338

351

-

Iprscan [seg]

414

425

-

PD690753

325

431

S=282 I=64 E=1.14114e-26

PD000660

84

391

S=273 I=30 E=1.33393e-25

PD897042

1

34

S=179 I=97 E=3.89646e-14

PD690751

47

103

S=161 I=81 E=4.75373e-12

PDA1O2A6

297

324

S=140 I=100 E=1.69488e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3Ob1rQFE)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

54 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23500.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23500.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
argB XFF4834R_chr23530
XFF4834R_chr23520
XFF4834R_chr23520
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23540
XFF4834R_chr23540
ID argB
AC XFF4834R_chr23530
LT XFF4834R_chr23530
OR XFF4834R_chr from 2723425 to 2724768 on strand -
DE acetylglutamate kinase
IP Aspartate/glutamate/uridylate kinase; Acetylglutamate kinase;
CL 1.5.1.3 Arginine GO:0006526
EC
GO InterPro
Biological Process: arginine biosynthetic process (GO:0006526)
Biological Process: cellular amino acid biosynthetic process (GO:0008652)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: acetylglutamate kinase activity (GO:0003991)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 49368.7 Da
SQ 447 aa
 
........10........20........30........40........50
| | | | |
MSSSAQPHKQTRQTIVRLLSSMASAKEISQYLKRFSQLDAKRFAVVKVGG
AVLRDDLDALTSSLSFLQEVGLTPIVLHGAGPQLDAELSAAGIEKHTING
LRVTSPEALAIVRKVFQASNLKLVEALQQNGARATSITGGVFEAEYLDRD
TYGLVGEVNAVNLAPIEASLQAGSIPVITSLGETPSGQILNVNADFAANE
LVQELQPYKIIFLTGTGGLLDADGKLIDSINLSTEFDHLMQQPWINGGMR
VKIEQIKDLLDRLPLESSVSITRPSDLAKELFTHKGSGTLVRRGERVLRA
TSWDELDLPRLKSLIESSFGRTLVPEYFHTTTLLRAYVSENYRAAVILTE
EGQLGAGRLTYLDKFAVLDDAQGEGLGRAVWNVMREETPQLFWRSRHNNQ
VNIFYYAESDGCIKQEKWKVFWYGLENFEQIQHCVAHCATRQPTLLG
XFF4834R

NP_642664.1 lcl|argB-XAC2348

1

447

S=2290 I=97 E=0

acetylglutamate kinase

XFF4834R

NP_637600.1 lcl|argB-XCC2245

1

447

S=2215 I=94 E=0

acetylglutamate kinase

XFF4834R

YP_364278.1 lcl|argB-XCV2547

22

447

S=2189 I=97 E=0

acetylglutamate kinase

XFF4834R

lcl|argB-XALc_1892

8

447

S=2045 I=88 E=0

probable acetylglutamate kinase protein

pubmed

3

435

S=844 I=41 E=2.09374e-93

Protein ARG5,6, mitochondrial EC=1.2.1.38 EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Kinase Mitochondrion Multifunctional enzyme

Pubmed 1851947

 

prodomImg

pubmed

5

435

S=833 I=40 E=4.42792e-92

Protein arg11, mitochondrial EC=1.2.1.38 EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Cleavage pair of basic residues Kinase Mi

Pubmed 1313366

 

prodomImg

pubmed

11

425

S=823 I=39 E=6.00295e-91

Protein ARG5,6, mitochondrial EC=1.2.1.38 EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Kinase Mitochondrion Multifunctional enzyme NADP

Pubmed 9043106

 

prodomImg

pubmed

11

431

S=796 I=40 E=1.26741e-87

Protein arg-6, mitochondrial EC=1.2.1.38 EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Kinase Mitochondrion Multifunctional enzyme

Pubmed 7907589

 

prodomImg

pubmed

23

437

S=532 I=34 E=1.28897e-55

N-acetylglutamate synthase, mitochondrial EC=2.3.1.1 ; Acyltransferase Disease mutation Mitochondrion Transit peptide Urea cycle

Pubmed 12754705

 

prodomImg

pubmed

28

437

S=502 I=33 E=4.71351e-52

N-acetylglutamate synthase, mitochondrial EC=2.3.1.1 ; Acyltransferase Alternative splicing Mitochondrion Transit peptide Urea cycle

Pubmed 12049647

 

prodomImg

pubmed

31

291

S=303 I=33 E=6.49103e-28

Acetylglutamate kinase EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 15150219

 

prodomImg

pubmed

41

253

S=256 I=33 E=3.6645e-22

Acetylglutamate kinase EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Nucleotide-binding Transferase

Pubmed 8025667

 

prodomImg

pubmed

3

291

S=246 I=29 E=5.46804e-21

Acetylglutamate kinase-like protein ; Transferase

Pubmed 11435398

 

prodomImg

pubmed

29

291

S=243 I=29 E=1.2302e-20

N-acetyl glutamate kinase 2 ; Transferase

Pubmed 15653795

 

prodomImg

sp_Pdown

sp|Q8PK29|ARGB_XANAC

22

447

S=2181 I=97 E=0

Acetylglutamate kinase EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q8P8J6|ARGB_XANCP

22

447

S=2117 I=94 E=0

Acetylglutamate kinase EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q9PEM7|ARGB_XYLFA

22

446

S=1806 I=79 E=0

Acetylglutamate kinase EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q87EL2|ARGB_XYLFT

22

446

S=1792 I=78 E=0

Acetylglutamate kinase EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Nucleotide-binding Transferase

sp_Pdown

sp|Q01217|ARG56_YEAST

3

435

S=844 I=41 E=1.44123e-93

Protein ARG5,6, mitochondrial EC=1.2.1.38 EC=2.7.2.8 ; Amino-acid biosynthesis Arginine ATP-binding Kinase Mitochondrion Multifunctional enzyme

Iprscan IPR001048 [G3DSA:3.40.1160.10]

40

291

Aspartate/glutamate/uridylate kinase

Iprscan IPR011242 [PIRSF036441]

22

447

N-acetylglutamate kinase, DUF619 domain-containing

Iprscan IPR001048 [PF00696]

42

273

Aspartate/glutamate/uridylate kinase

Iprscan IPR006855 [PF04768]

276

441

Protein of unknown function DUF619

Iprscan IPR004662 [TIGR00761]

43

269

Acetylglutamate kinase

Iprscan [seg]

213

220

-

PD017400

255

446

S=447 I=46 E=1.10905e-46

PD414861

48

283

S=232 I=32 E=1.23686e-20

PDA3I6Z4

6

254

S=183 I=23 E=1.25233e-14

PD347672

45

201

S=170 I=30 E=4.16766e-13

PDA1K9O8

22

48

S=129 I=100 E=4.48908e-08

PD102705

2

54

S=108 I=43 E=1.58663e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one pL0Rj3b0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

55 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23530.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23530.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23530.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23530.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
argG XFF4834R_chr23560
XFF4834R_chr23550
XFF4834R_chr23550
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr23570
XFF4834R_chr23570
ID argG
AC XFF4834R_chr23560
LT XFF4834R_chr23560
OR XFF4834R_chr from 2726613 to 2727854 on strand -
DE argininosuccinate synthetase
IP Argininosuccinate synthase; Rossmann-like alpha/beta/alpha sandwich fold; Argininosuccinate synthase, conserved site
CL 1.5.1.3 Arginine GO:0006526
EC
GO InterPro
Biological Process: arginine biosynthetic process (GO:0006526)
Molecular Function: ATP binding (GO:0005524)
Molecular Function: argininosuccinate synthase activity (GO:0004055)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110221)
MW 45037.6 Da
SQ 413 aa
 
........10........20........30........40........50
| | | | |
MSQQTASTNPESPIPTSGTKDIVLAFSGGLDTSFCIPYLQERGYAVHTVF
ADTGGVDAEEREFIEKRAAELGAASHVTVDGGPAIWEGFVKPFVWAGEGY
QGQYPLLVSDRYLIVDAALKRAEELGTRIIAHGCTGMGNDQVRFDLAVKA
LGDYQIVAPIREIQKEHTQTRAYEQKYLEARGFGVRAKQQAYTINENLLG
LTMSGGEIDRWEAPGEGARGWCAPRSAWPSEALTVTLKFVEGEAVELDGK
PLPGAKILAKLNTLFAQYGVGRGVYTGDTVIGLKGRIVFEAPGLISLLTA
HRALEDAVLTKQQNRFKPDVARKWVELVYEGFYHDPLKSDIEAFLKSSQS
KVNGEVTLETRGGRVDAVAVRSPHLLNTKGATYAQSADWGVEEAEGFIKL
FGMSSTLYAQVNR
Hamap ASSY_MF_00005 raw_score=8144 norm_score=39.677

Argininosuccinate synthase [argG].

XFF4834R

NP_642667.1 lcl|argG-XAC2351

6

413

S=2141 I=99 E=0

argininosuccinate synthase

XFF4834R

YP_364281.1 lcl|argG-XCV2550

6

413

S=2140 I=99 E=0

argininosuccinate synthase

XFF4834R

NP_637602.1 lcl|argG-XCC2247

19

413

S=2044 I=97 E=0

argininosuccinate synthase

XFF4834R

lcl|argG-XALc_1895

1

413

S=1911 I=88 E=0

probable argininosuccinate synthase protein

pubmed

17

413

S=596 I=35 E=1.92333e-63

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 9387221

 

prodomImg

pubmed

19

413

S=578 I=35 E=2.6281e-61

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 18281406

 

prodomImg

pubmed

22

413

S=574 I=33 E=1.05123e-60

Putative argininosuccinate synthase (ArgG)/acetyltransferase activity of N-acetylglutamate synthase (ArgA) ; ATP-binding Amino-acid biosynthesis Arginine C

Pubmed 18048332

 

prodomImg

pubmed

22

412

S=562 I=34 E=2.28209e-59

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 19014707

 

prodomImg

pubmed

22

407

S=554 I=34 E=2.53167e-58

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 18408034

 

prodomImg

pubmed

19

407

S=551 I=35 E=5.35855e-58

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 17194220

 

prodomImg

pubmed

19

410

S=547 I=34 E=1.76929e-57

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 8566818

 

prodomImg

pubmed

19

409

S=544 I=36 E=4.30548e-57

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 12446909

 

prodomImg

pubmed

18

412

S=537 I=33 E=3.03528e-56

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 7596286

 

prodomImg

pubmed

19

409

S=528 I=33 E=3.16788e-55

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 18505588

 

prodomImg

sp_Pdown

sp|Q8PK26|ASSY_XANAC

6

413

S=2141 I=99 E=0

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

sp_Pdown

sp|Q8P8J4|ASSY_XANCP

19

413

S=2044 I=97 E=0

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

sp_Pdown

sp|P59606|ASSY_XYLFT

19

413

S=1819 I=84 E=0

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

sp_Pdown

sp|Q9PEM9|ASSY_XYLFA

20

413

S=1812 I=84 E=0

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

sp_Pdown

sp|Q9K820|ASSY_BACHD

20

412

S=610 I=36 E=2.93071e-65

Argininosuccinate synthase EC=6.3.4.5 ; Amino-acid biosynthesis Arginine ATP-binding Cytoplasm Ligase Nucleotide-binding

Iprscan IPR014729 [G3DSA:3.40.50.620]

20

192

Rossmann-like alpha/beta/alpha sandwich fold

Iprscan [G3DSA:3.90.1260.10]

192

412

-

Iprscan [MF_00005]

19

413

-

Iprscan IPR001518 [PF00764]

23

411

Argininosuccinate synthase

Iprscan IPR001518 [TIGR00032]

21

413

Argininosuccinate synthase

Iprscan IPR018223 [PS00564]

25

33

Argininosuccinate synthase, conserved site

Iprscan IPR018223 [PS00565]

133

144

Argininosuccinate synthase, conserved site

PD341294

197

413

S=340 I=34 E=1.0761e-33

PDA1K707

153

196

S=214 I=93 E=1.65776e-18

PD580210

89

196

S=192 I=44 E=9.22017e-16

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 8TYEQdGt)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23560.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23560.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr23560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr27630390_2915886_f1_XFF4834R-XFF4834R_chr25270 XFF4834R_chr25270
XFF4834R_chr25260
XFF4834R_chr25260
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr25280
XFF4834R_chr25280
ID XFF4834R_chr27630390_2915886_f1_XFF4834R-XFF4834R_chr25270
AC XFF4834R_chr25270
LT XFF4834R_chr25270
OR XFF4834R_chr from 2914390 to 2915886 on strand +
DE putative ornithine/acetylornithine aminotransferase
IP Aminotransferase class-III; Pyridoxal phosphate-dependent transferase, major region, subdomain 1
CL 1.5.1.3 Arginine GO:0006526
EC
GO InterPro
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: transaminase activity (GO:0008483)
Molecular Function: pyridoxal phosphate binding (GO:0030170)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20101112)
MW 53536.2 Da
SQ 498 aa
 
........10........20........30........40........50
| | | | |
MSALAPLAPLRAHAGRRLTEGLDDATIARLAVSHPDLQQAIHAAAAEYAL
VRDDAADLLDLDEEAQIGAVQEGFINFYADDAVTPYVALAARGPWVVTLK
GAVLYDAGGYGMLGFGHTPAAVLEAMARPQVMANVMTPSLAQRRLDRALR
AEIGHSRGGCPFARFMCLNSGSEAVGLAARIVDTNAKLHTDPGARHAGAT
IKRLVVKGSFHGRTDRPGLYSDSSRKTYTKYLASYRDEDSVIAIAPYDVA
ALQRAFDEAARNHWFIEAVFLEPVMGEGDPGRALPAEFYAAARALTRTHG
SLLLVDSIQAGLRAHGVLSVVDYPGFEQLDPPDLETYSKALNAAQYPLSV
LAVTEHAAQVYRKGTYGNTMTTNPRALDVACATLALFTPQVRDNIRIRGA
QAIAKLEALQSELGGLITKVQGTGLLFSCELAPQFKCYGAGSTEEWLRHR
GVNVIHGGENSLRFTPHFAMDEDELDLLVGLIARALKEGPRQLQAEAA
XFF4834R

XFF4834R_chr12180 lcl|astC-XFF4834R_chr12180

165

475

S=264 I=32 E=3.18497e-25

succinylornithine transaminase, PLP-dependent

XFF4834R

XFF4834R_chr15660 lcl|bioA-XFF4834R_chr15660

266

431

S=97 I=28 E=4.55692e-05

7,8-diaminopelargonic acid synthase, PLP-dependent

XFF4834R

XFF4834R_chr12180 lcl|astC-XFF4834R_chr12180

165

475

S=264 I=32 E=3.18497e-25

succinylornithine transaminase, PLP-dependent

XFF4834R

XFF4834R_chr15660 lcl|bioA-XFF4834R_chr15660

266

431

S=97 I=28 E=4.55692e-05

7,8-diaminopelargonic acid synthase, PLP-dependent

pubmed

19

492

S=1835 I=72 E=0

L-lysine 6-aminotransferase ; Pyridoxal phosphate

Pubmed 10965037

 

prodomImg

pubmed

86

475

S=253 I=27 E=9.12867e-22

Acetylornithine/succinyldiaminopimelate aminotransferase EC=2.6.1.11 EC=2.6.1.17 ; Amino-acid biosynthesis Arginine Cytoplasm Lysine Pyridoxal phos

Pubmed 2403545

 

prodomImg

pubmed

164

476

S=244 I=28 E=1.04865e-20

Acetylornithine/succinyldiaminopimelate aminotransferase EC=2.6.1.11 EC=2.6.1.17 ; Amino-acid biosynthesis Arginine Cytoplasm Lysine Pyridoxal phosp

Pubmed 2199330

 

prodomImg

pubmed

165

475

S=226 I=30 E=1.66184e-18

Succinylornithine transaminase EC=2.6.1.81 ; Aminotransferase Arginine metabolism Pyridoxal phosphate

Pubmed 9696780

 

prodomImg

pubmed

108

479

S=221 I=30 E=7.38041e-18

Acetylornithine/acetyl-lysine aminotransferase EC=2.6.1.11 EC=2.6.1.- ; Amino-acid biosynthesis Arginine Cytoplasm Pyridoxal phosphate

Pubmed 11489859

 

prodomImg

pubmed

204

486

S=216 I=26 E=2.52335e-17

Acetylornithine aminotransferase EC=2.6.1.11 ; Amino-acid biosynthesis Arginine Cytoplasm Pyridoxal phosphate

Pubmed 7929012

 

prodomImg

pubmed

100

486

S=216 I=26 E=2.75323e-17

Ornithine aminotransferase EC=2.6.1.13 ; Cytoplasm Pyridoxal phosphate

Pubmed 2824201

 

prodomImg

pubmed

100

491

S=208 I=25 E=2.75093e-16

Omega-aminotransferase ; Pyridoxal phosphate

Pubmed 16163487

 

prodomImg

pubmed

85

477

S=206 I=27 E=4.32891e-16

Ornithine aminotransferase 2 EC=2.6.1.13 ; Amino-acid biosynthesis Cytoplasm Proline Pyridoxal phosphate

Pubmed 15590099

 

prodomImg

pubmed

162

491

S=205 I=28 E=5.38321e-16

Ornithine aminotransferase EC=2.6.1.13 ; Cytoplasm Pyridoxal phosphate

Pubmed 10079330

 

prodomImg

sp_Pdown

sp|Q8PH31|ARGD_XANAC

165

475

S=265 I=32 E=2.18825e-23

Acetylornithine aminotransferase EC=2.6.1.11 ; Amino-acid biosynthesis Arginine Cytoplasm Pyridoxal phosphate

sp_Pdown

sp|Q9JYY4|ARGD_NEIMB

165

475

S=257 I=30 E=2.14863e-22

Acetylornithine aminotransferase EC=2.6.1.11 ; Amino-acid biosynthesis Arginine Cytoplasm Pyridoxal phosphate

sp_Pdown

sp|Q8Z1Z3|ARGD_SALTI

86

476

S=256 I=27 E=2.89003e-22

Acetylornithine/succinyldiaminopimelate aminotransferase EC=2.6.1.11 EC=2.6.1.17 ; Amino-acid biosynthesis Arginine Cytoplasm Lysine Pyridoxal pho

sp_Pdown

sp|P40732|ARGD_SALTY

86

475

S=253 I=27 E=6.27916e-22

Acetylornithine/succinyldiaminopimelate aminotransferase EC=2.6.1.11 EC=2.6.1.17 ; Amino-acid biosynthesis Arginine Cytoplasm Lysine Pyridoxal phos

sp_Pdown

sp|Q9JTX9|ARGD_NEIMA

165

474

S=252 I=30 E=8.74558e-22

Acetylornithine aminotransferase EC=2.6.1.11 ; Amino-acid biosynthesis Arginine Cytoplasm Pyridoxal phosphate

Iprscan IPR015421 [G3DSA:3.40.640.10]

120

390

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan IPR005814 [PTHR11986]

76

494

Aminotransferase class-III

Iprscan IPR005814 [PF00202]

90

432

Aminotransferase class-III

Iprscan [seg]

3

18

-

Iprscan [seg]

40

49

-

Iprscan [seg]

53

65

-

Iprscan [seg]

140

151

-

PDA1S1G0

19

270

S=1083 I=83 E=1.08397e-123

PD308202

340

492

S=777 I=95 E=1.65385e-86

Iprscan IPR015424 [SSF53383]

59

488

Pyridoxal phosphate-dependent transferase, major domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 6wR2ahch)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

69 hits
swiss-prot

Swiss-Prot ncbi-blastp

215 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr25270.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr25270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr25270.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwwebcb/XFF4834R_chr25270.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.