Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr16160aroBXFF4834R_chr161603-dehydroquinate synthase
  2. XFF4834R_chr16170aroKXFF4834R_chr16170shikimate kinase I

aroB XFF4834R_chr16160
XFF4834R_chr16150
XFF4834R_chr16150
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16170
XFF4834R_chr16170
ID aroB
AC XFF4834R_chr16160
LT XFF4834R_chr16160
OR XFF4834R_chr from 1871771 to 1872883 on strand -
DE 3-dehydroquinate synthase
IP 3-dehydroquinate synthase AroB; 3-dehydroquinate synthase
CL 1.5.1.20 Chorismate GO:0009423
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Biological Process: aromatic amino acid family biosynthetic process (GO:0009073)
Molecular Function: 3-dehydroquinate synthase activity (GO:0003856)
acting on phosphates (GO:0016838)

Curated
PM
AN according to GenProtEC
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 38752 Da
SQ 370 aa
 
........10........20........30........40........50
| | | | |
MTLSRSSRSVDVDGAQPYTITIAPGLLADGARLASHVRGRHALLLSDSQV
APHYAAGVRAALLGARPDLQVGELVIAAGEASKTLETFGSAITALAELGA
TRDACVFALGGGVVGDLAGFAAACWMRGVDCVQLPTSLLAMVDSSVGGKT
AVDIPQGKNLVGAFHPPRAVIADTDTLRTLPARELRAGLAEVIKYGAIRD
PLFFQWLHAERRALLDGDAAALAQAIARSCEHKAEIVARDPLEKGERALL
NLGHTFGHAIETEQGYGAPGNDNLNHGEAVAVGMVLAARLSAALEMSDPQ
DTEALRALLHDFDLPTEIPPGLAPQALLARMRLDKKNIAGRLRLVLWRGI
GKAEVVPDVEEAAVLEILAG
Hamap AROB_MF_00110 raw_score=7006 norm_score=39.210

3-dehydroquinate synthase [aroB].

XFF4834R

NP_643320.1 lcl|aroB-XAC3011

1

370

S=1506 I=82 E=2.75718e-175

3-dehydroquinate synthase

XFF4834R

YP_364892.1 lcl|aroB-XCV3161

1

370

S=1479 I=80 E=5.06329e-172

3-dehydroquinate synthase

XFF4834R

NP_638190.1 lcl|aroB-XCC2842

1

352

S=1392 I=78 E=1.5462e-161

3-dehydroquinate synthase

XFF4834R

lcl|AroB-XALc_2166

3

351

S=1209 I=69 E=2.22788e-139

putative 3-dehydroquinate synthase protein

pubmed

8

352

S=623 I=44 E=1.01274e-66

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 19077236

 

prodomImg

pubmed

4

349

S=585 I=38 E=4.00235e-62

Dehydroquinate synthase EC=4.6.1.3 ; Lyase

Pubmed 8704160

 

prodomImg

pubmed

14

352

S=585 I=42 E=4.1444e-62

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cobalt Cytoplasm Lyase NAD

Pubmed 9405209

 

prodomImg

pubmed

8

352

S=551 I=40 E=5.2727e-58

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 7901733

 

prodomImg

pubmed

8

352

S=542 I=41 E=6.725e-57

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cobalt Cytoplasm Lyase NAD

Pubmed 3009224,7603433

 

prodomImg

pubmed

124

351

S=536 I=52 E=3.01281e-56

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 18700039

 

prodomImg

pubmed

15

345

S=527 I=41 E=4.26647e-55

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 9613570

 

prodomImg

pubmed

134

352

S=509 I=53 E=5.8809e-53

3-dehydroquinate synthase ; NAD

Pubmed 12904568

 

prodomImg

pubmed

18

352

S=506 I=36 E=1.37005e-52

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 18812508

 

prodomImg

pubmed

16

346

S=493 I=37 E=4.80429e-51

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Pubmed 18043661

 

prodomImg

sp_Pdown

sp|Q8PI87|AROB_XANAC

1

370

S=1506 I=82 E=7.29408e-174

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

sp_Pdown

sp|Q3BQS1|AROB_XANC5

1

370

S=1479 I=80 E=1.33948e-170

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

sp_Pdown

sp|Q2P6C9|AROB_XANOM

1

370

S=1466 I=79 E=4.8216e-169

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

sp_Pdown

sp|Q5H3H4|AROB_XANOR

1

370

S=1463 I=79 E=1.09427e-168

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

sp_Pdown

sp|B2SKP5|AROB_XANOP

1

370

S=1463 I=79 E=1.09427e-168

3-dehydroquinate synthase EC=4.2.3.4 ; Amino-acid biosynthesis Aromatic Cytoplasm Lyase NAD

Iprscan [G3DSA:3.40.50.1970]

4

179

-

Iprscan [G3DSA:1.20.1090.10]

180

357

-

Iprscan [MF_00110]

8

370

-

Iprscan IPR016303 [PIRSF001455]

1

369

3-dehydroquinate synthase

Iprscan IPR002658 [PF01761]

22

338

3-dehydroquinate synthase AroB

Iprscan IPR016037 [TIGR01357]

18

368

3-dehydroquinate synthase AroB, subgroup

Iprscan [seg]

55

66

-

Iprscan [seg]

106

123

-

Iprscan [seg]

209

228

-

Iprscan [seg]

353

366

-

PD194122

37

352

S=630 I=43 E=7.9424e-69

PD496999

1

43

S=163 I=79 E=3.27925e-12

PDA2I0T1

294

327

S=145 I=85 E=4.5597e-10

PD859554

328

351

S=117 I=96 E=1.0972e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Xqh2eg0B)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

94 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8GTbKA/XFF4834R_chr16160.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8GTbKA/XFF4834R_chr16160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8GTbKA/XFF4834R_chr16160.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8GTbKA/XFF4834R_chr16160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
aroK XFF4834R_chr16170
XFF4834R_chr16160
XFF4834R_chr16160
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16180
XFF4834R_chr16180
ID aroK
AC XFF4834R_chr16170
LT XFF4834R_chr16170
OR XFF4834R_chr from 1872880 to 1873440 on strand -
DE shikimate kinase I
IP Shikimate kinase
CL 1.5.1.20 Chorismate GO:0009423
EC
GO InterPro
Molecular Function: ATP binding (GO:0005524)
Molecular Function: shikimate kinase activity (GO:0004765)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130515)
MW 20618.5 Da
SQ 186 aa
 
........10........20........30........40........50
| | | | |
MLRSLCMNPAPNLVMVGPMGAGKSCIGRRLAERFGLEFVDVDQAIVEQVG
SSIPAIFEQHGEARFRQHEAQTLQALLEQDNKLISTGGGAVLDPRNRERI
CARGFVVYLHVSVPAQLTRLARDRNRPLLQRADREQVLHAMAAHRTPLYH
QVADLSLETDHLSPAEATAQLVLRLAAQWRMSSNPA
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VtkrnaJe)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

29 hits
swiss-prot

Swiss-Prot ncbi-blastp

444 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8GTbKA/XFF4834R_chr16170.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8GTbKA/XFF4834R_chr16170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8GTbKA/XFF4834R_chr16170.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8GTbKA/XFF4834R_chr16170.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.