Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr01720glnA1XFF4834R_chr01720probable glutamine synthetase GlnA
  2. XFF4834R_chr24620glnA2XFF4834R_chr24620putative glutamine synthetase
  3. XFF4834R_chr24630XFF4834R_chr24630putative glutamine amidotransferase
  4. XFF4834R_chr24640XFF4834R_chr26930858_2844237_f1_XFF4834R-XFF4834R_chr24640XFF4834R_chr24640putative glutamine synthase
  5. XFF4834R_chr38190glnBXFF4834R_chr38190probable nitrogen regulatory protein P-II

glnA1 XFF4834R_chr01720
XFF4834R_chr01710
XFF4834R_chr01710
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01730
XFF4834R_chr01730
ID glnA1
AC XFF4834R_chr01720
LT XFF4834R_chr01720
OR XFF4834R_chr from 209508 to 210917 on strand +
DE probable glutamine synthetase GlnA
IP Glutamine synthetase type I; Glutamine synthetase, type III
CL 1.5.1.2 Glutamine GO:0006542
EC
GO InterPro
Biological Process: nitrogen fixation (GO:0009399)
Biological Process: glutamine biosynthetic process (GO:0006542)
Biological Process: nitrogen compound metabolic process (GO:0006807)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: glutamate-ammonia ligase activity (GO:0004356)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 51845.4 Da
SQ 469 aa
 
........10........20........30........40........50
| | | | |
MSVENVEKLIKDNKVEFVDLRFVDMRGVQQHITFPVNIIEPALFEEGKMF
DGSSIAGWKGINESDMVLLPDAGTAYLDPFFADPTIVLTCDILDPATMQS
YERDPRGIAKRAEAYLKSSGTADQAFFGPEPEFFIFDSVRFANDMGHTFF
QVGSEEAAWNTGEKYDGGNSGYRPGVKGGYFPVPPTDSLHDLRAEMIKTL
EQVGIETEVHHHEVATAGQCEIGTKFSSLVQKADELLTMKYIIKNVAYRN
GKTATFMPKPIVGDNGSGMHVHQSLAKGGVNLFTGDGYGGLSQLALWYIG
GIFKHARAINAFANSGTNSYKRLVPGFEAPVMLAYSARNRSASCRIPWVT
NPKARRIEMRFPDPLQSGYLTFTALMMAGLDGIKNQIDPGAPSDKDLYDL
PPEEEKLIPQVCSSLDQALEALDKDREFLKAGGVMSDDFIDGYIALKMQE
VTKFRAATHPLEYQLYYGN
XFF4834R

XFF4834R_chr24620 lcl|XFF4834R_chr26910567_2841952_r3_XFF4834R-XFF4834R_chr24620

62

454

S=308 I=28 E=1.40516e-30

XFF4834R

XFF4834R_chr24640 lcl|puuA-XFF4834R_chr24640

201

398

S=199 I=32 E=2.20645e-17

gamma-Glu-putrescine synthase

XFF4834R

YP_361919.1 lcl|glnA-XCV0188

1

469

S=2520 I=100 E=0

glutamine synthetase, type I

XFF4834R

NP_640560.1 lcl|glnA-XAC0204

1

469

S=2520 I=100 E=0

glutamine synthetase

XFF4834R

NP_635580.1 lcl|glnA-XCC0185

1

469

S=2492 I=98 E=0

glutamine synthetase

XFF4834R

lcl|glnA-XALc_3093

1

469

S=2329 I=90 E=0

probable glutamate--ammonia ligase protein

XFF4834R

NP_637700.1 lcl|glnA-XCC2346

62

454

S=320 I=29 E=1.73636e-31

glutamine synthetase

XFF4834R

YP_364387.1 lcl|glnA2-XCV2656

62

454

S=309 I=28 E=3.64024e-30

putative glutamine synthetase

XFF4834R

NP_642793.1 lcl|glnA-XAC2478

62

454

S=308 I=28 E=4.44856e-30

glutamine synthetase

XFF4834R

lcl|XALc_2094

62

454

S=281 I=26 E=7.68566e-27

putative glutamine synthetase protein

XFF4834R

lcl|XALc_2372

52

454

S=230 I=25 E=1.45783e-20

putative glutamine synthetase, catalytic domain protein

XFF4834R

lcl|XALc_2096

198

398

S=212 I=32 E=1.90705e-18

putative glutamine synthase protein

pubmed

1

467

S=1795 I=69 E=0

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 1969923

 

prodomImg

pubmed

28

347

S=1699 I=98 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 18943306

 

prodomImg

pubmed

2

467

S=1692 I=66 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 11064198

 

prodomImg

pubmed

1

467

S=1687 I=66 E=0

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 2574025

 

prodomImg

pubmed

1

467

S=1679 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 2879772

 

prodomImg

pubmed

1

467

S=1672 I=63 E=0

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 2882477,2874141

 

prodomImg

pubmed

1

467

S=1668 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 8095910

 

prodomImg

pubmed

1

467

S=1661 I=63 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 15644904

 

prodomImg

pubmed

8

467

S=1650 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nitrogen fixation Nucleotide-binding

Pubmed 1977737

 

prodomImg

pubmed

8

467

S=1622 I=64 E=0

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 16495669

 

prodomImg

Iprscan [G3DSA:3.10.20.70]

1

104

-

Iprscan IPR014746 [G3DSA:3.30.590.10]

105

469

Glutamine synthetase/guanido kinase, catalytic region

Iprscan IPR008147 [PF03951]

14

95

Glutamine synthetase, beta-Grasp

Iprscan IPR008146 [PF00120]

102

383

Glutamine synthetase, catalytic region

Iprscan IPR004809 [TIGR00653]

4

468

Glutamine synthetase type I

Iprscan IPR008147 [PS00180]

50

68

Glutamine synthetase, beta-Grasp

Iprscan IPR008146 [PS00181]

259

274

Glutamine synthetase, catalytic region

PD001057

110

467

S=821 I=51 E=6.07814e-92

PD228027

11

105

S=276 I=55 E=6.22175e-26

PDA4S9L6

90

157

S=109 I=37 E=1.08785e-05

PD692080

4

125

S=103 I=25 E=5.55449e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vYq3T0Fx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

401 hits
swiss-prot

Swiss-Prot ncbi-blastp

87 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr01720.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr01720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr01720.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr01720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
glnA2 XFF4834R_chr24620
XFF4834R_chr24610
XFF4834R_chr24610
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24630
XFF4834R_chr24630
ID glnA2
AC XFF4834R_chr24620
LT XFF4834R_chr24620
OR XFF4834R_chr from 2840567 to 2841952 on strand -
DE putative glutamine synthetase
IP Glutamine synthetase, type III
CL 1.5.1.2 Glutamine GO:0006542
EC
GO InterPro
Biological Process: glutamine biosynthetic process (GO:0006542)
Biological Process: nitrogen compound metabolic process (GO:0006807)
Molecular Function: glutamate-ammonia ligase activity (GO:0004356)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL:
CC STATUS: curated by darrasse (20120320)
MW 51505.9 Da
SQ 461 aa
 
........10........20........30........40........50
| | | | |
MSIRTRSRKTTPTQPESALRRWLKERSITEVECLVPDITGNARGKIIPAD
KFSHDYGTRLPEGIFATTVTGDFPDDYYALTSPSDSDMHLRPDASTVRMV
PWAADPTAQVIHDCYTKDGQPHELAPRNVLRRVLDAYAQAELQPVVAPEL
EFFLVQKNTDPDFPLLPPAGRSGRPETARQSYSIDAVNEFDPILDLMYDY
CDAMELDVDTLIHESGAAQLEVNFTHADPMSRADQVFLFKRTMREAALRH
GVYATFLAKPMETEPGSAMHIHQSLLHAGTGKNVFSGKREGGFSDTFAHY
LGGLQKYIPMAMGLLAPNVNSYRRLMFGEVSPSNVLWGFDNRTCGLRVPI
DVPQNMRVESRFAGSDANPYLAMAATLACGLLGIGEKLEPTAPISSNGKE
QGYDLPRSLGEALDELEGCEALQEMLGRRFVRAYISVKRKEYETFFRVIS
SWEREFLLLNV
XFF4834R

XFF4834R_chr24640 lcl|puuA-XFF4834R_chr24640

31

441

S=605 I=36 E=1.40654e-66

gamma-Glu-putrescine synthase

XFF4834R

XFF4834R_chr01720 lcl|glnA-XFF4834R_chr01720

84

445

S=308 I=28 E=1.37684e-30

glutamine synthetase

XFF4834R

NP_642793.1 lcl|glnA-XAC2478

1

461

S=2470 I=100 E=0

glutamine synthetase

XFF4834R

YP_364387.1 lcl|glnA2-XCV2656

1

461

S=2450 I=99 E=0

putative glutamine synthetase

XFF4834R

NP_637700.1 lcl|glnA-XCC2346

1

461

S=2411 I=97 E=0

glutamine synthetase

XFF4834R

lcl|XALc_2094

1

461

S=2113 I=86 E=0

putative glutamine synthetase protein

XFF4834R

NP_642795.1 lcl|glnA-XAC2480

31

441

S=620 I=36 E=7.52322e-68

glutamine synthase

XFF4834R

NP_637702.1 lcl|glnA-XCC2348

31

441

S=605 I=35 E=4.41267e-66

glutamine synthase

XFF4834R

lcl|XALc_2096

11

461

S=596 I=33 E=5.62809e-65

putative glutamine synthase protein

XFF4834R

YP_364389.1 lcl|glnA3-XCV2658

31

441

S=592 I=35 E=1.99253e-64

putative glutamine synthase

XFF4834R

lcl|XALc_2372

19

453

S=516 I=32 E=3.03165e-55

putative glutamine synthetase, catalytic domain protein

XFF4834R

lcl|glnA-XALc_3093

84

445

S=327 I=30 E=2.19184e-32

probable glutamate--ammonia ligase protein

pubmed

19

460

S=625 I=36 E=6.12054e-67

Gamma-glutamylputrescine synthetase

Pubmed 15590624

 

prodomImg

pubmed

22

461

S=577 I=33 E=5.20543e-61

Glutamine synthetase

Pubmed 17991023

 

prodomImg

pubmed

85

451

S=512 I=35 E=3.58527e-53

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 9172372

 

prodomImg

pubmed

25

449

S=510 I=33 E=6.48641e-53

Glutamine synthetase 1 EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 8098326

 

prodomImg

pubmed

25

449

S=501 I=33 E=7.85136e-52

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 7916055

 

prodomImg

pubmed

49

305

S=500 I=40 E=1.01986e-51

Branched-chain keto acid dehydrogenase

Pubmed 2211503

 

prodomImg

pubmed

19

453

S=477 I=31 E=5.19866e-49

Putative gamma-glutamylisopropylamide synthetase

Pubmed 18783384

 

prodomImg

pubmed

19

455

S=477 I=30 E=5.77204e-49

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 2906311,2565853

 

prodomImg

pubmed

85

455

S=469 I=33 E=6.29262e-48

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 2572584

 

prodomImg

pubmed

19

453

S=468 I=31 E=6.98666e-48

Glutamine synthetase type I EC=6.3.1.2 ; Ligase

Pubmed 15933046

 

prodomImg

Iprscan [G3DSA:3.10.20.70]

12

118

-

Iprscan IPR014746 [G3DSA:3.30.590.10]

126

458

Glutamine synthetase/guanido kinase, catalytic region

Iprscan IPR008147 [PF03951]

84

117

Glutamine synthetase, beta-Grasp

Iprscan IPR008146 [PF00120]

123

384

Glutamine synthetase, catalytic region

Iprscan IPR008146 [PS00181]

259

274

Glutamine synthetase, catalytic region

PD001057

201

455

S=371 I=41 E=1.94541e-37

PD488431

37

139

S=252 I=52 E=4.80305e-23

PDA1X4G5

1

34

S=165 I=94 E=1.87228e-12

PDA1G841

427

461

S=156 I=80 E=2.07705e-11

PDA1G177

144

181

S=144 I=71 E=5.90833e-10

PD434850

35

85

S=144 I=51 E=6.73383e-10

PD780570

144

256

S=142 I=35 E=1.11655e-09

PDA1G459

182

212

S=119 I=65 E=6.43046e-07

PDA2R1L3

216

345

S=109 I=28 E=1.19322e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one wjeoYNIo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

306 hits
swiss-prot

Swiss-Prot ncbi-blastp

79 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24620.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24620.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24620.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr24630
XFF4834R_chr24620
XFF4834R_chr24620
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24640
XFF4834R_chr24640
ID
AC XFF4834R_chr24630
LT XFF4834R_chr24630
OR XFF4834R_chr from 2841959 to 2842714 on strand -
DE putative glutamine amidotransferase
IP Peptidase C26; Glutamine amidotransferase type 1
CL 1.5.1.2 Glutamine GO:0006542
EC
GO InterPro
Biological Process: glutamine metabolic process (GO:0006541)
Molecular Function: hydrolase activity (GO:0016787)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120307)
MW 26964.5 Da
SQ 251 aa
 
........10........20........30........40........50
| | | | |
MAVVPLVGLPTDRILQGPHRFLAAGEKYIRAVVEAAGAMPVLLPSLQPAL
DAGAWLERLDGLLLTGAVSNVEPHHYSDEPSWEGNPHDPARDATSLGLIP
QALARSLPVLAICRGLQEVNVALGGRLHQRVHDVPGLADHREDAGTPIDM
QYGPAHVVHLHPGGWLAGMSDSAQVWVNSLHGQGIATLAEGLLIEATAPD
GLIEAFHGPGPGFLLAVQWHPEWRVTQHPFYRAIFQAFGEACRQYAARRG
K
XFF4834R

NP_642794.1 lcl|guaA-XAC2479

1

251

S=1264 I=98 E=3.5029e-146

glutamine amidotransferase

XFF4834R

YP_364388.1 lcl|XCV2657

1

251

S=1243 I=96 E=9.95596e-144

putative glutamine amidotransferase

XFF4834R

NP_637701.1 lcl|guaA-XCC2347

1

251

S=1166 I=90 E=2.34252e-134

glutamine amidotransferase

XFF4834R

lcl|XALc_2095

1

251

S=823 I=67 E=8.51848e-93

putative glutamine amidotransferase protein

XFF4834R

lcl|XALc_2369

2

249

S=348 I=37 E=2.87563e-35

putative predicted glutamine amidotransferases protein

pubmed

19

251

S=538 I=46 E=1.02134e-56

Glutamine amidotransferase ; Plasmid

Pubmed 15240330

 

prodomImg

pubmed

5

251

S=462 I=40 E=1.91567e-47

Gamma-glutamyl-gamma-aminobutyrate hydrolase

Pubmed 15590624

 

prodomImg

pubmed

6

245

S=365 I=40 E=9.19791e-36

Putative glutamine amidotransferase

Pubmed 11679318,14711685

 

prodomImg

pubmed

5

235

S=274 I=33 E=1.18384e-24

Putative uncharacterized protein orf201

Pubmed 11807057

 

prodomImg

pubmed

33

235

S=260 I=36 E=5.6327e-23

Putative uncharacterized protein orf201

Pubmed 12620620

 

prodomImg

pubmed

33

235

S=260 I=35 E=5.68202e-23

Putative uncharacterized protein orf201

Pubmed 12620620

 

prodomImg

pubmed

33

235

S=259 I=35 E=6.58982e-23

Putative uncharacterized protein orf201

Pubmed 12620620

 

prodomImg

pubmed

33

242

S=198 I=38 E=1.75473e-15

Putative glutamine amidotransferase

Pubmed 12446651,12598647

 

prodomImg

pubmed

1

192

S=186 I=29 E=5.44619e-14

Putative glutamine amidotransferase-like protein yvdE homolog

Pubmed 1674656

 

prodomImg

pubmed

23

133

S=148 I=29 E=2.04264e-09

Putative glutamine amidotransferase-like protein RP404

Pubmed 11030655

 

prodomImg

sp_Pdown

sp|Q8X7G2|PUUD_ECO57

5

251

S=464 I=41 E=7.77009e-48

Gamma-glutamyl-gamma-aminobutyrate hydrolase EC=3.5.1.94 ; Glutamine amidotransferase

sp_Pdown

sp|Q3Z146|PUUD_SHISS

5

251

S=462 I=40 E=1.32252e-47

Gamma-glutamyl-gamma-aminobutyrate hydrolase EC=3.5.1.94 ; Glutamine amidotransferase

sp_Pdown

sp|P76038|PUUD_ECOLI

5

251

S=462 I=40 E=1.32252e-47

Gamma-glutamyl-gamma-aminobutyrate hydrolase EC=3.5.1.94

sp_Pdown

sp|Q83LB6|PUUD_SHIFL

5

251

S=443 I=40 E=2.62913e-45

Gamma-glutamyl-gamma-aminobutyrate hydrolase EC=3.5.1.94 ; Glutamine amidotransferase

sp_Pdown

sp|Q9CE00|YVDE_LACLA

1

240

S=275 I=31 E=5.47265e-25

Putative glutamine amidotransferase-like protein yvdE

Iprscan [G3DSA:3.40.50.880]

5

222

-

Iprscan IPR011697 [PF07722]

5

222

Peptidase C26

Iprscan IPR017926 [PS51273]

18

248

Glutamine amidotransferase type 1

PDA1F818

192

251

S=176 I=59 E=6.62245e-14

PD410082

26

92

S=171 I=53 E=2.67214e-13

PDA1U3G9

165

191

S=128 I=93 E=4.15105e-08

PDA311L5

1

25

S=116 I=96 E=1.52049e-06

PDA1G783

98

129

S=113 I=72 E=2.92396e-06

PDA438Q9

154

223

S=109 I=33 E=1.05339e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one K1J4bMlz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24630.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24630.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr26930858_2844237_f1_XFF4834R-XFF4834R_chr24640 XFF4834R_chr24640
XFF4834R_chr24630
XFF4834R_chr24630
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24650
XFF4834R_chr24650
ID XFF4834R_chr26930858_2844237_f1_XFF4834R-XFF4834R_chr24640
AC XFF4834R_chr24640
LT XFF4834R_chr24640
OR XFF4834R_chr from 2842858 to 2844237 on strand +
DE putative glutamine synthase
IP Glutamine synthetase, type III
CL 1.5.1.2 Glutamine GO:0006542
EC
GO InterPro
Biological Process: nitrogen compound metabolic process (GO:0006807)
Biological Process: glutamine biosynthetic process (GO:0006542)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: glutamate-ammonia ligase activity (GO:0004356)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by koebnik (20101112)
MW 49245.2 Da
SQ 459 aa
 
........10........20........30........40........50
| | | | |
MASETSVASLPAADAHTLSRIAGCESVDLLLPDTNGVLRGKRVSADALRK
VYRDGVCLPMSLIATDITGNTVEETGLGYAIGDADRICRPIEGSLRPVPW
APRPMAQLLLAMHTPEGGLFEVAPRAVLQRVLQGFGALGLTPVIAVELEF
YLFDAVADAQGRPQTPRDPITGERSDSTQVYSLQDLDDQRGFTDAVTVAC
RQQGIPADTAVAEYAPGQFEINLQHRADAVAACDEAVLLKRTIKAIAQQQ
GKLASFMAKPFPGQAGSGLHLHVSLLDAAGHNVLASAPDAPAQPLRHAIA
GLQRHADASLLMFAPHANSYRRFVSNAFVPLDASWGFNNRTVALRIPHSD
AHNTRIEHRIAGADANPYLVAAAVLAAILDGLRQPAEPAAPITGNAYAQS
VFAPRSWQGAVDAFLGSDFIGEQFGTQFQHVFGQQKQRELLDYQAQVPDL
DYARYLRTV
XFF4834R

XFF4834R_chr24620 lcl|XFF4834R_chr26910567_2841952_r3_XFF4834R-XFF4834R_chr24620

27

439

S=605 I=34 E=1.39931e-66

XFF4834R

XFF4834R_chr01720 lcl|glnA-XFF4834R_chr01720

201

397

S=199 I=30 E=2.15087e-17

glutamine synthetase

XFF4834R

XFF4834R_chr24620 lcl|XFF4834R_chr26910567_2841952_r3_XFF4834R-XFF4834R_chr24620

27

439

S=605 I=34 E=1.39931e-66

XFF4834R

XFF4834R_chr01720 lcl|glnA-XFF4834R_chr01720

201

397

S=199 I=30 E=2.15087e-17

glutamine synthetase

pubmed

18

458

S=873 I=42 E=6.692e-97

Gamma-glutamylputrescine synthetase

Pubmed 15590624

 

prodomImg

pubmed

33

459

S=782 I=42 E=6.07717e-86

Glutamine synthetase

Pubmed 17991023

 

prodomImg

pubmed

24

459

S=438 I=31 E=2.77223e-44

Gamma-glutamylisopropylamide synthetase

Pubmed 11976110

 

prodomImg

pubmed

9

454

S=414 I=29 E=2.36366e-41

Putative gamma-glutamylisopropylamide synthetase

Pubmed 18783384

 

prodomImg

pubmed

17

456

S=398 I=27 E=2.40122e-39

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 1348781

 

prodomImg

pubmed

31

459

S=395 I=30 E=5.49731e-39

Putative glutamine synthetase

Pubmed 11679318,14711685

 

prodomImg

pubmed

29

456

S=376 I=27 E=9.02102e-37

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 10613874

 

prodomImg

pubmed

7

457

S=373 I=27 E=2.59073e-36

Glutamine synthetase EC=6.3.1.2 ; Ligase

Pubmed 17768251

 

prodomImg

pubmed

12

453

S=371 I=29 E=4.64642e-36

Glutamine synthetase

Pubmed 15618615

 

prodomImg

pubmed

81

456

S=370 I=29 E=5.29561e-36

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Pubmed 2906311,2565853

 

prodomImg

sp_Pdown

sp|P78061|PUUA_ECOLI

18

458

S=873 I=42 E=4.60558e-97

Gamma-glutamylputrescine synthetase EC=6.3.1.11 ; ATP-binding Ligase Nucleotide-binding

sp_Pdown

sp|O27612|GLNA_METTH

81

456

S=401 I=29 E=6.44493e-40

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

sp_Pdown

sp|P36205|GLNA_THEMA

17

456

S=398 I=27 E=1.65257e-39

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

sp_Pdown

sp|P12425|GLNA_BACSU

81

456

S=370 I=29 E=3.64456e-36

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

sp_Pdown

sp|P10656|GLNA_CLOSA

7

457

S=369 I=27 E=4.85959e-36

Glutamine synthetase EC=6.3.1.2 ; ATP-binding Cytoplasm Ligase Nucleotide-binding

Iprscan IPR014746 [G3DSA:3.30.590.10]

124

458

Glutamine synthetase/guanido kinase, catalytic domain

Iprscan [PTHR20852:SF7]

26

457

-

Iprscan [PTHR20852]

26

457

-

Iprscan IPR008146 [PF00120]

123

377

Glutamine synthetase, catalytic domain

Iprscan [seg]

369

377

-

PD001057

150

400

S=370 I=37 E=3.01874e-37

PD692655

414

459

S=229 I=96 E=3.6689e-20

PD488431

26

139

S=217 I=43 E=8.46599e-19

PD780570

142

256

S=165 I=41 E=2.01443e-12

PDA1T091

141

168

S=144 I=100 E=7.05803e-10

PD592700

169

217

S=142 I=57 E=1.11066e-09

PDA2M5D1

1

30

S=139 I=93 E=2.43426e-09

PDA4L6P7

142

216

S=129 I=37 E=3.99793e-08

PDA4L6K2

1

30

S=113 I=77 E=3.85446e-06

Iprscan [SSF55931]

121

458

-

Iprscan IPR008147 [SSF54368]

11

121

Glutamine synthetase, beta-Grasp

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one hni4NgQO)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

300 hits
swiss-prot

Swiss-Prot ncbi-blastp

81 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24640.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24640.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr24640.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
glnB XFF4834R_chr38190
XFF4834R_chr_4063
XFF4834R_chr_4063
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38200
XFF4834R_chr38200
ID glnB
AC XFF4834R_chr38190
LT XFF4834R_chr38190
OR XFF4834R_chr from 4415207 to 4415545 on strand -
DE probable nitrogen regulatory protein P-II
IP Nitrogen regulatory protein PII; Nitrogen regulatory PII-like, alpha/beta; Nitrogen regulatory protein PII, conserved site
CL 1.5.1.2 Glutamine GO:0006542
EC
GO InterPro
Biological Process: regulation of nitrogen utilization (GO:0006808)
Molecular Function: enzyme regulator activity (GO:0030234)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110303)
MW 11984.8 Da
SQ 112 aa
 
........10........20........30........40........50
| | | | |
MKMIMAIVKPFKLDDVREALAGCGVAGITVTEVKGFGRQKGHTELYRGAE
YVVDFLPKVKIEVAVTDDQAERVVEAIVGAAGTGKIGDGKVFVYDLGTVV
RIRTGELDSDAL
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr01730 lcl|glnK-XFF4834R_chr01730

1

112

S=435 I=76 E=6.15666e-47

nitrogen assimilation regulatory protein for GlnL, GlnE, and AmtB

XFF4834R

XFF4834R_chr01730 lcl|glnK-XFF4834R_chr01730

1

112

S=435 I=76 E=6.15666e-47

nitrogen assimilation regulatory protein for GlnL, GlnE, and AmtB

pubmed

1

112

S=446 I=75 E=3.04449e-46

GlnK ; Transcription regulation

Pubmed 12180140

 

prodomImg

pubmed

1

112

S=428 I=71 E=3.65011e-44

PII-like protein Pz PZ protein ; Transcription regulation

Pubmed 8763942,9720864

 

prodomImg

pubmed

1

112

S=425 I=72 E=9.44138e-44

PII-protein ; Transcription regulation

Pubmed 9620984

 

prodomImg

pubmed

1

112

S=421 I=72 E=3.28477e-43

P2-like signal transmitter protein GlnK PII-like signal transmitter protein GlnK ; Transcription regulation

Pubmed 11069654

 

prodomImg

pubmed

1

112

S=417 I=70 E=9.5161e-43

GlnK protein ; Transcription regulation

Pubmed 9671036

 

prodomImg

pubmed

1

112

S=408 I=71 E=1.24589e-41

Nitrogen regulatory protein P-II ; fixation Nucleotide-binding Transcription regulation

Pubmed 2907369

 

prodomImg

pubmed

1

112

S=406 I=70 E=1.66124e-41

P2-like signal transmitter protein GlnB PII-like signal transmitter protein GlnB ; Transcription regulation

Pubmed 11069654

 

prodomImg

pubmed

1

112

S=401 I=71 E=7.06306e-41

Nitrogen regulatory protein P-II 1 ; Nucleotide-binding Transcription regulation

Pubmed 2885322,2907369

 

prodomImg

pubmed

1

112

S=400 I=70 E=1.01865e-40

Nitrogen regulatory protein P-II ; fixation Nucleotide-binding Transcription regulation

Pubmed 8931324

 

prodomImg

pubmed

1

112

S=397 I=67 E=2.68119e-40

Nitrogen regulatory protein P-II 2 ; Nucleotide-binding Transcription regulation

Pubmed 7590157

 

prodomImg

sp_Pdown

sp|Q9CJK1|GLNB_PASMU

1

112

S=422 I=70 E=1.80196e-43

Nitrogen regulatory protein P-II ; Nucleotide-binding Transcription regulation

sp_Pdown

sp|P11671|GLNB_KLEOX

1

112

S=408 I=71 E=9.03414e-42

Nitrogen regulatory protein P-II ; fixation Nucleotide-binding Transcription regulation

sp_Pdown

sp|P0A9Z6|GLNB_SHIFL

1

112

S=401 I=71 E=5.12155e-41

Nitrogen regulatory protein P-II 1 ; Nucleotide-binding Transcription regulation

sp_Pdown

sp|P0A9Z4|GLNB_SALTY

1

112

S=401 I=71 E=5.12155e-41

Nitrogen regulatory protein P-II 1 ; Nucleotide-binding Transcription regulation

sp_Pdown

sp|P0A9Z5|GLNB_SALTI

1

112

S=401 I=71 E=5.12155e-41

Nitrogen regulatory protein P-II 1 ; Nucleotide-binding Transcription regulation

Iprscan IPR002187 [PR00340]

2

17

Nitrogen regulatory protein PII

Iprscan IPR002187 [PR00340]

23

41

Nitrogen regulatory protein PII

Iprscan IPR002187 [PR00340]

52

75

Nitrogen regulatory protein PII

Iprscan IPR002187 [PR00340]

83

103

Nitrogen regulatory protein PII

Iprscan IPR015867 [G3DSA:3.30.70.120]

1

112

Nitrogen regulatory protein PII/ATP phosphoribosyltransferase, C-terminal

Iprscan IPR002187 [PF00543]

4

105

Nitrogen regulatory protein PII

Iprscan IPR002332 [PS00496]

46

51

Nitrogen regulatory protein P-II, urydylation site

Iprscan IPR017918 [PS00638]

83

96

Nitrogen regulatory protein PII, conserved site

Iprscan IPR002187 [PS51343]

1

112

Nitrogen regulatory protein PII

PD001194

9

100

S=341 I=73 E=7.07812e-34

PDA1D007

1

112

S=187 I=45 E=3.81731e-15

PDA6F7W5

55

112

S=169 I=62 E=5.30786e-13

PDA46244

1

106

S=124 I=32 E=1.58565e-07

Iprscan IPR011322 [SSF54913]

1

112

Nitrogen regulatory PII-like, alpha/beta

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one OSkcDbv8)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

81 hits
swiss-prot

Swiss-Prot ncbi-blastp

49 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr38190.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr38190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr38190.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBTWwktM/XFF4834R_chr38190.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.