Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr11890leuCXFF4834R_chr118903-isopropylmalate isomerase subunit, dehydratase component
  2. XFF4834R_chr11900leuDXFF4834R_chr119003-isopropylmalate isomerase subunit
  3. XFF4834R_chr11910leuBXFF4834R_chr11910probable 3-isopropylmalate dehydrogenase
  4. XFF4834R_chr11920leuAXFF4834R_chr119202-isopropylmalate synthase

leuC XFF4834R_chr11890
XFF4834R_chr11880
XFF4834R_chr11880
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11900
XFF4834R_chr11900
ID leuC
AC XFF4834R_chr11890
LT XFF4834R_chr11890
OR XFF4834R_chr from 1335282 to 1336721 on strand +
DE 3-isopropylmalate isomerase subunit, dehydratase component
IP Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha; Homoaconitase/3-isopropylmalate dehydratase, small/large subunit; Aconitase family, 4Fe-4S cluster binding site
CL 1.5.1.19 Leucine GO:0009098
EC
GO InterPro
4 sulfur cluster binding (GO:0051539)
Biological Process: leucine biosynthetic process (GO:0009098)
Biological Process: metabolic process (GO:0008152)
Molecular Function: 3-isopropylmalate dehydratase activity (GO:0003861)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 51429.1 Da
SQ 479 aa
 
........10........20........30........40........50
| | | | |
MTAKTLYDKLWELHEVTRRDDGSSLIYIDRHILHEVTSPQAFEGLRLAGR
KPWRIDANIATLDHNVPTTRAERQGGLESISDEVSRLQVQTLDENCDDFG
ILEFKMNDARQGIVHVVGPEQGATLPGMTVVCGDSHTSTHGAFGALAHGI
GTSEVEHVLATQCLIAKKMKNMQVRVEGTLPFGVTAKDIVLAVIGKIGTA
GGNGHALEFAGSAIRALSMEGRMTICNMSIEAGARVGMVAVDEKTIAYVK
GRPFAPKGANWEAAVALWSTLVSDPDAHFDTVVELRAEDIKPQVSWGTSP
EMVLAIDQHVPDPAIEQDPTKRDSIERALKYMGLKANQPITAIRLDRVFI
GSCTNSRIEDLRAAAAVAKGRKVASSIKQALVVPGSGLVKAQAEAEGLDK
VFLDAGFEWREPGCSMCLAMNPDKLGSGEHCASTSNRNFEGRQGAGGRTH
LVSPAMAAAAAVSGHFVDVRELQGIESRE
Hamap LEUC_MF_01026 raw_score=17293 norm_score=61.645

3-isopropylmalate dehydratase large subunit [leuC].

XFF4834R

XFF4834R_chr20230 lcl|acnA-XFF4834R_chr20230

129

301

S=187 I=31 E=6.37867e-16

aconitate hydratase 1

XFF4834R

XFF4834R_chr11330 lcl|acnA-XFF4834R_chr11330

122

250

S=171 I=36 E=4.49308e-14

aconitate hydratase 1

XFF4834R

NP_643765.1 lcl|leuC-XAC3458

1

479

S=2389 I=94 E=0

isopropylmalate isomerase large subunit

XFF4834R

YP_365317.1 lcl|leuC-XCV3586

1

472

S=2342 I=93 E=0

isopropylmalate isomerase large subunit

XFF4834R

NP_638677.1 lcl|leuC-XCC3331

1

479

S=2340 I=92 E=0

isopropylmalate isomerase large subunit

XFF4834R

lcl|leuC-XALc_0753

4

472

S=1194 I=53 E=2.28179e-137

probable 3-isopropylmalate dehydratase large subunit protein

XFF4834R

NP_642208.1 lcl|rpfA-XAC1882

129

301

S=184 I=31 E=5.33037e-15

aconitate hydratase

XFF4834R

NP_637225.1 lcl|rpfA-XCC1860

129

301

S=181 I=31 E=1.0991e-14

aconitate hydratase

XFF4834R

YP_363655.1 lcl|acnA-XCV1924

129

301

S=181 I=31 E=1.2747e-14

aconitate hydratase

XFF4834R

lcl|acnA-XALc_1349

129

301

S=175 I=32 E=6.07005e-14

probable aconitate hydratase 1 protein

XFF4834R

NP_641475.1 lcl|acnA-XAC1139

122

250

S=174 I=36 E=8.98639e-14

aconitate hydratase

XFF4834R

YP_362889.1 lcl|acnA-XCV1158

122

250

S=171 I=36 E=1.69824e-13

aconitate hydratase

pubmed

3

472

S=1745 I=69 E=0

3-isopropylmalate dehydratase large subunit ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Leucine Lyase Metal-binding

Pubmed 12754231

 

prodomImg

pubmed

1

471

S=1682 I=68 E=0

3-isopropylmalate dehydratase large subunit EC=4.2.1.33 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Leucine Lyase Metal-binding

Pubmed 19077236

 

prodomImg

pubmed

1

473

S=1545 I=64 E=2.67806e-178

3-isopropylmalate dehydratase large subunit EC=4.2.1.33 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Leucine Lyase Metal-b

Pubmed 12070767

 

prodomImg

pubmed

4

472

S=1535 I=61 E=3.82564e-177

3-isopropylmalate dehydratase EC=4.2.1.33 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Leucine Lyase Metal-binding

Pubmed 8766701

 

prodomImg

pubmed

4

471

S=1513 I=62 E=1.77175e-174

3-isopropylmalate dehydratase EC=4.2.1.33 ; Lyase

Pubmed 11489863

 

prodomImg

pubmed

3

473

S=1507 I=60 E=9.95707e-174

Putative alpha-isopropylmalate isomerase EC=4.2.1.33 ; Lyase

Pubmed 15088140

 

prodomImg

pubmed

5

473

S=1506 I=60 E=1.38682e-173

3-isopropylmalate dehydratase EC=4.2.1.33 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Leucine Lyase Metal-binding

Pubmed 2693214

 

prodomImg

pubmed

4

473

S=1504 I=60 E=2.12597e-173

3-isopropylmalate dehydratase EC=4.2.1.33 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Leucine Lyase Metal-binding Phosphopro

Pubmed 1840714

 

prodomImg

pubmed

3

473

S=1503 I=60 E=3.17495e-173

Putative alpha-isopropylmalate isomerase EC=4.2.1.33 ; Lyase

Pubmed 15088140

 

prodomImg

pubmed

3

473

S=1480 I=60 E=1.81264e-170

3-isopropylmalate dehydratase large subunit EC=4.2.1.33 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Leucine Lyase Metal-bin

Pubmed 2124684,1630901

 

prodomImg

Iprscan IPR015931 [G3DSA:3.30.499.10]

1

170

Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 1/3

Iprscan IPR015932 [G3DSA:3.40.1060.10]

172

287

Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 2

Iprscan IPR015931 [G3DSA:3.30.499.10]

322

472

Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha, subdomain 1/3

Iprscan IPR004430 [MF_01026]

2

473

3-isopropylmalate dehydratase, large subunit region

Iprscan IPR001030 [PF00330]

5

464

Aconitase/3-isopropylmalate dehydratase large subunit, alpha/beta/alpha

Iprscan IPR004430 [TIGR00170]

2

472

3-isopropylmalate dehydratase, large subunit region

Iprscan IPR018136 [PS00450]

345

361

Aconitase family, 4Fe-4S cluster binding site

Iprscan IPR018136 [PS01244]

406

419

Aconitase family, 4Fe-4S cluster binding site

Iprscan [seg]

362

376

-

Iprscan [seg]

455

461

-

PD000511

112

475

S=628 I=43 E=1.62404e-68

PDA1X271

204

307

S=364 I=62 E=1.38737e-36

PD556812

413

454

S=210 I=88 E=7.88412e-18

PD299828

126

203

S=194 I=54 E=5.80096e-16

PD738556

1

46

S=175 I=68 E=1.08493e-13

PD581395

47

111

S=169 I=54 E=5.73622e-13

PDA7S6E4

343

411

S=167 I=52 E=1.26823e-12

PDA3N4B3

301

334

S=145 I=82 E=5.92493e-10

PDA318B8

310

361

S=144 I=50 E=7.62943e-10

PDA231C4

310

339

S=130 I=83 E=3.38549e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ElAiYqby)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

166 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11890.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11890.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
leuD XFF4834R_chr11900
XFF4834R_chr11890
XFF4834R_chr11890
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11910
XFF4834R_chr11910
ID leuD
AC XFF4834R_chr11900
LT XFF4834R_chr11900
OR XFF4834R_chr from 1336799 to 1337446 on strand +
DE 3-isopropylmalate isomerase subunit
IP Aconitase A/isopropylmalate dehydratase small subunit, swivel
CL 1.5.1.19 Leucine GO:0009098
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: leucine biosynthetic process (GO:0009098)
Cellular Component: 3-isopropylmalate dehydratase complex (GO:0009316)
Molecular Function: 3-isopropylmalate dehydratase activity (GO:0003861)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 24293.1 Da
SQ 215 aa
 
........10........20........30........40........50
| | | | |
MTPFTQHTGLVAPLDRANVDTDQIIPKQFLKSIKRTGFGPNLFDEWRYLD
IGEPGRDNSTRPLNPEFVLNFRRYQGASVLLARENFGCGSSREHAPWALD
EYGFRTVIAPSFADIFYNNSFKNGLLPIVLAEAQVDALFEQCLATEGYQL
TVDLAAQRVRRHDGVEYGFDIDAFRKHCLLNGLDDIGLTLQDADAIGRFE
QGHRARQPWLFGALQ
Hamap LEUD_MF_01031 raw_score=5572 norm_score=43.668

3-isopropylmalate dehydratase small subunit [leuD].

XFF4834R

YP_365316.1 lcl|leuD-XCV3585

1

215

S=1124 I=99 E=2.59004e-129

isopropylmalate isomerase small subunit

XFF4834R

NP_643764.1 lcl|leuD-XAC3457

1

215

S=1115 I=98 E=2.75074e-128

isopropylmalate isomerase small subunit

XFF4834R

NP_638676.1 lcl|leuD-XCC3330

1

215

S=1083 I=95 E=2.03825e-124

isopropylmalate isomerase small subunit

XFF4834R

lcl|leuD-XALc_0752

1

203

S=431 I=46 E=2.37284e-45

probable 3-isopropylmalate dehydratase small subunit protein

pubmed

1

215

S=936 I=82 E=4.84661e-105

3-isopropylmalate dehydratase small subunit EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase

Pubmed 9108283

 

prodomImg

pubmed

1

214

S=827 I=73 E=9.21957e-92

3-isopropylmalate dehydratase small subunit ; Amino-acid biosynthesis Branched-chain Leucine Lyase

Pubmed 12754231

 

prodomImg

pubmed

4

205

S=661 I=65 E=9.80699e-72

3-isopropylmalate dehydratase small subunit 1 EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase

Pubmed 2993799

 

prodomImg

pubmed

4

208

S=642 I=63 E=2.38251e-69

3-isopropylmalate dehydratase small subunit EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase

Pubmed 1630901

 

prodomImg

pubmed

1

211

S=577 I=57 E=1.6126e-61

3-isopropylmalate dehydratase small subunit EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase

Pubmed 19077236

 

prodomImg

pubmed

1

212

S=558 I=53 E=3.59054e-59

3-isopropylmalate dehydratase EC=4.2.1.33 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Leucine Lyase Metal-binding

Pubmed 8901103

 

prodomImg

pubmed

1

201

S=549 I=51 E=3.58754e-58

3-isopropylmalate dehydratase small subunit EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase Plasmid

Pubmed 9812361

 

prodomImg

pubmed

1

212

S=546 I=54 E=9.60886e-58

3-isopropylmalate dehydratase EC=4.2.1.33 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Leucine Lyase Metal-binding

Pubmed 8766701

 

prodomImg

pubmed

1

212

S=545 I=54 E=1.16406e-57

Putative alpha-isopropylmalate isomerase EC=4.2.1.33 ; Lyase

Pubmed 15088140

 

prodomImg

pubmed

1

212

S=545 I=54 E=1.19491e-57

Putative alpha-isopropylmalate isomerase EC=4.2.1.33 ; Lyase

Pubmed 15088140

 

prodomImg

sp_Pdown

sp|Q3BPJ7|LEUD_XANC5

1

215

S=1124 I=99 E=6.39964e-128

3-isopropylmalate dehydratase small subunit EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase

sp_Pdown

sp|Q8PH04|LEUD_XANAC

1

215

S=1115 I=98 E=6.7967e-127

3-isopropylmalate dehydratase small subunit EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase

sp_Pdown

sp|Q5H4D0|LEUD_XANOR

1

215

S=1095 I=96 E=1.81739e-124

3-isopropylmalate dehydratase small subunit EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase

sp_Pdown

sp|B2SNH3|LEUD_XANOP

1

215

S=1095 I=96 E=1.81739e-124

3-isopropylmalate dehydratase small subunit EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase

sp_Pdown

sp|Q2P764|LEUD_XANOM

1

215

S=1095 I=96 E=1.81739e-124

3-isopropylmalate dehydratase small subunit EC=4.2.1.33 ; Amino-acid biosynthesis Branched-chain Leucine Lyase

Iprscan IPR015928 [G3DSA:3.20.19.10]

14

134

Aconitase/3-isopropylmalate dehydratase, swivel

Iprscan IPR004431 [MF_01031]

1

210

3-isopropylmalate dehydratase, small subunit region

Iprscan IPR000573 [PF00694]

1

133

Aconitase A/isopropylmalate dehydratase small subunit, swivel

Iprscan IPR004431 [TIGR00171]

1

196

3-isopropylmalate dehydratase, small subunit region

PDA1E493

150

205

S=161 I=60 E=5.23367e-12

PD001077

79

138

S=135 I=45 E=6.96102e-09

PD018132

29

78

S=119 I=60 E=5.53986e-07

PD858170

1

26

S=117 I=81 E=1.1523e-06

PD489052

77

134

S=112 I=43 E=3.7389e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one n110nlrR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

65 hits
swiss-prot

Swiss-Prot ncbi-blastp

470 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11900.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11900.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11900.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
leuB XFF4834R_chr11910
XFF4834R_chr11900
XFF4834R_chr11900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11920
XFF4834R_chr11920
ID leuB
AC XFF4834R_chr11910
LT XFF4834R_chr11910
OR XFF4834R_chr from 1337540 to 1338613 on strand +
DE probable 3-isopropylmalate dehydrogenase
IP Isocitrate/isopropylmalate dehydrogenase; Isopropylmalate dehydrogenase; Isocitrate/isopropylmalate dehydrogenase, conserved site
CL 1.5.1.19 Leucine GO:0009098
EC
GO InterPro
Biological Process: leucine biosynthetic process (GO:0009098)
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: NAD or NADH binding (GO:0051287)
Molecular Function: 3-isopropylmalate dehydrogenase activity (GO:0003862)
Molecular Function: magnesium ion binding (GO:0000287)
NAD or NADP as acceptor (GO:0016616)

Curated
PM
AN
CC COG: [CE] Energy production and conversion;Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100506)
MW 38189.4 Da
SQ 357 aa
 
........10........20........30........40........50
| | | | |
MSKQILILPGDGIGPEIMAEAVKVLKRIDAQHGLGFQLVYDELGGAAYDK
YGSPLADETLERARGADAVLLGAVGGPQWDTIDPSLRPERGLLKIRSQLG
LFANLRPALLYPQLADASTLKPEVVAGLDLLILRELTGGIYFGQPRGNRT
LDNGERQAYDTLPYSESEIRRIAKAGFDMARLRGKKLCSVDKANVLASSQ
LWRAVVEEVAKDYPDIALSHMYVDNAAMQLVRAPKQFDVIVTDNMFGDIL
SDQASMLTGSIGMLPSASLDANSKGMYEPCHGSAPDIAGKGIANPLATIL
SVAMMLRYTFAQADAADAIERAVGKVLDQGLRTADIWSEGTTKVGTVAMG
DAVVAAL
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr10500 lcl|XFF4834R_chr11120960_1193967_f1_XFF4834R-XFF4834R_chr10500

1

308

S=440 I=36 E=9.60803e-47

predicted dehydrogenase

XFF4834R

XFF4834R_chr10500 lcl|XFF4834R_chr11120960_1193967_f1_XFF4834R-XFF4834R_chr10500

1

308

S=440 I=36 E=9.60803e-47

predicted dehydrogenase

XFF4834R

YP_365315.1 lcl|leuB-XCV3584

1

357

S=1722 I=93 E=0

3-isopropylmalate dehydrogenase

XFF4834R

NP_643763.1 lcl|leuB-XAC3456

1

357

S=1716 I=93 E=0

3-isopropylmalate dehydrogenase

XFF4834R

NP_638674.1 lcl|leuB-XCC3328

1

357

S=1650 I=90 E=0

3-isopropylmalate dehydrogenase

XFF4834R

lcl|leuB-XALc_0751

1

357

S=802 I=47 E=5.19396e-90

probable 3-isopropylmalate dehydrogenase protein

XFF4834R

YP_362807.1 lcl|XCV1076

1

308

S=444 I=37 E=1.1372e-46

isocitrate dehydrogenase

XFF4834R

NP_636353.1 lcl|icd-XCC0967

1

308

S=441 I=37 E=2.67247e-46

isocitrate dehydrogenase

XFF4834R

NP_641393.1 lcl|icd-XAC1046

1

308

S=440 I=36 E=3.6261e-46

isocitrate dehydrogenase

XFF4834R

lcl|XALc_0579

1

295

S=439 I=39 E=4.09686e-46

putative isocitrate dehydrogenase protein

XFF4834R

lcl|XALc_3137

2

357

S=404 I=33 E=7.45194e-42

putative isocitrate dehydrogenase protein

pubmed

1

357

S=1466 I=78 E=7.21908e-169

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxi

Pubmed 9108278

 

prodomImg

pubmed

1

357

S=1313 I=74 E=2.09643e-150

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxidoreducta

Pubmed 9108283

 

prodomImg

pubmed

4

357

S=1097 I=61 E=2.98449e-124

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxidoreduct

Pubmed 12754231

 

prodomImg

pubmed

1

310

S=1064 I=65 E=3.60349e-120

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxidoreducta

Pubmed 8190068

 

prodomImg

pubmed

3

357

S=1027 I=58 E=8.89342e-116

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Metal-binding NAD Oxidoreductase

Pubmed 8282728,9739088

 

prodomImg

pubmed

2

354

S=1011 I=56 E=8.06663e-114

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Branched-chain amino acid biosynthesis Leucine Metal-binding NAD Oxidoreductase

Pubmed 16758443

 

prodomImg

pubmed

4

357

S=976 I=55 E=1.42939e-109

3-isopropylmalate dehydrogenase, chloroplastic EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Leucine Magnesium Manganese Metal-binding NAD Oxidoreductase

Pubmed 1371407

 

prodomImg

pubmed

4

357

S=947 I=54 E=5.22699e-106

3-isopropylmalate dehydrogenase 3, chloroplastic EC=1.1.1.85 ; Alternative splicing Amino-acid biosynthesis Branched-chain Leucine Magnesium M

Pubmed 9501997

 

prodomImg

pubmed

1

357

S=944 I=52 E=1.15564e-105

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxid

Pubmed 3110742,8969504

 

prodomImg

pubmed

3

357

S=925 I=52 E=2.27743e-103

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxi

Pubmed 8336106

 

prodomImg

sp_Pdown

sp|Q3BPJ8|LEU3_XANC5

1

357

S=1722 I=93 E=0

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxidoreduct

sp_Pdown

sp|Q8PH05|LEU3_XANAC

1

357

S=1716 I=93 E=0

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxidoreduct

sp_Pdown

sp|Q5H4C7|LEU3_XANOR

1

357

S=1706 I=92 E=0

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxidoreduct

sp_Pdown

sp|Q2P762|LEU3_XANOM

1

357

S=1706 I=92 E=0

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxidoreductase

sp_Pdown

sp|Q8P5L1|LEU3_XANCP

1

357

S=1650 I=90 E=0

3-isopropylmalate dehydrogenase EC=1.1.1.85 ; Amino-acid biosynthesis Branched-chain Cytoplasm Leucine Magnesium Manganese Metal-binding NAD Oxidoreduct

PDA1F709

133

208

S=264 I=65 E=1.60247e-24

PD186037

207

268

S=236 I=73 E=3.65949e-21

PDA92835

7

202

S=153 I=28 E=5.18848e-11

PDA0U7O8

305

357

S=134 I=51 E=8.89361e-09

PDA188O9

263

304

S=117 I=57 E=1.11379e-06

PDA1H4A2

109

134

S=116 I=88 E=1.29173e-06

PDA7L670

109

134

S=106 I=77 E=2.06672e-05

PDA7L681

109

134

S=106 I=77 E=2.39691e-05

PDA1F708

4

53

S=103 I=46 E=4.81473e-05

PDA7L687

109

134

S=103 I=77 E=5.53549e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ZVzJB9wp)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

262 hits
swiss-prot

Swiss-Prot ncbi-blastp

364 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
leuA XFF4834R_chr11920
XFF4834R_chr11910
XFF4834R_chr11910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11930
XFF4834R_chr11930
ID leuA
AC XFF4834R_chr11920
LT XFF4834R_chr11920
OR XFF4834R_chr from 1338907 to 1340469 on strand -
DE 2-isopropylmalate synthase
IP Alpha-isopropylmalate/homocitrate synthase, conserved site; 2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain
CL 1.5.1.19 Leucine GO:0009098
EC
GO InterPro
Biological Process: leucine biosynthetic process (GO:0009098)
Biological Process: metabolic process (GO:0008152)
Biological Process: carboxylic acid metabolic process (GO:0019752)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: 2-isopropylmalate synthase activity (GO:0003852)
acyl groups converted into alkyl on transfer (GO:0046912)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 56332.1 Da
SQ 520 aa
 
........10........20........30........40........50
| | | | |
MNTTVSNQTPRIRIFDTTLRDGEQSPGCSMTPQQKLVMARALDELGVDII
ETGFPASSHSDREAVAMMGRELRRPTLAVLSRCLQADIETSAKALETAAN
PRLHVFLSTSPLHREHKLRMSREQVLESVHRHVTLARGYIDDVEFSAEDA
TRTEEDFLAEVTRVAIAAGATTINLPDTVGFTTPEEIRGMFSRLIASVEG
ADKVIFSAHCHNDLGLAVANSLAAIEGGARQVECTINGIGERAGNCALEE
ITMALKVRGAFYNIDSAINTPRIVSTSQLLQRLVGMPVQRNKAVVGGNAF
AHESGIHQHGMLRHRGTYEIMRPEDVGWESSQMVLGRHSGRAAVEQRLRA
LGYLLEEEEVKLVFEQFKALCEKQRVVTDADLQALMQDATVQEGYRLASM
TISDVGSRANALVELSDPEGNRVAETAQGNGPVDALFGALASATGVKLEL
DSYQVHSVGIGADARGEASLSVRHDGVEYEGTGTSKDIIEASALAWLDVA
NRLLRQRERGVVASKTAAVA
Hamap LEU1_MF_01025_B raw_score=14302 norm_score=43.729

2-isopropylmalate synthase [leuA].

XFF4834R

XFF4834R_chr19960 lcl|XFF4834R_chr21420968_2290864_r3_XFF4834R-XFF4834R_chr19960

137

285

S=109 I=28 E=1.61302e-06

XFF4834R

YP_365314.1 lcl|leuA-XCV3583

1

520

S=2650 I=97 E=0

2-isopropylmalate synthase

XFF4834R

NP_643762.1 lcl|leuA-XAC3455

1

520

S=2649 I=97 E=0

2-isopropylmalate synthase

XFF4834R

NP_638673.1 lcl|leuA-XCC3327

1

520

S=2592 I=94 E=0

2-isopropylmalate synthase

XFF4834R

lcl|leuA-XALc_0755

1

517

S=2206 I=80 E=0

probable 2-isopropylmalate synthase protein

XFF4834R

NP_637197.1 lcl|mvaB-XCC1832

12

285

S=114 I=24 E=1.51031e-06

hydroxymethylglutaryl-CoA lyase

XFF4834R

NP_642177.1 lcl|mvaB-XAC1851

137

285

S=114 I=28 E=1.79802e-06

hydroxymethylglutaryl-CoA lyase

XFF4834R

YP_363628.1 lcl|mvaB-XCV1897

167

285

S=109 I=30 E=6.36558e-06

hydroxymethylglutaryl-CoA lyase

XFF4834R

lcl|mvaB-XALc_1332

158

285

S=102 I=30 E=4.64688e-05

probable hydroxymethylglutaryl-coa lyase protein

pubmed

51

472

S=1911 I=85 E=0

LeuA

Pubmed 18424531

 

prodomImg

pubmed

52

472

S=1908 I=85 E=0

LeuA

Pubmed 18424531

 

prodomImg

pubmed

51

471

S=1906 I=85 E=0

LeuA

Pubmed 18424531

 

prodomImg

pubmed

52

472

S=1905 I=85 E=0

LeuA

Pubmed 18424531

 

prodomImg

pubmed

52

471

S=1902 I=85 E=0

LeuA

Pubmed 18424531

 

prodomImg

pubmed

51

470

S=1901 I=85 E=0

LeuA

Pubmed 18424531

 

prodomImg

pubmed

53

472

S=1900 I=85 E=0

LeuA

Pubmed 18424531

 

prodomImg

pubmed

52

470

S=1899 I=85 E=0

LeuA

Pubmed 18424531

 

prodomImg

pubmed

52

470

S=1897 I=84 E=0

LeuA

Pubmed 18424531

 

prodomImg

pubmed

54

472

S=1895 I=84 E=0

LeuA

Pubmed 18424531

 

prodomImg

sp_Pdown

sp|P58900|LEU1_XANAC

1

520

S=2649 I=97 E=0

2-isopropylmalate synthase EC=2.3.3.13 ; Amino-acid biosynthesis Branched-chain Leucine Transferase

sp_Pdown

sp|P58901|LEU1_XANCP

1

520

S=2592 I=94 E=0

2-isopropylmalate synthase EC=2.3.3.13 ; Amino-acid biosynthesis Branched-chain Leucine Transferase

Iprscan IPR013785 [G3DSA:3.20.20.70]

4

284

Aldolase-type TIM barrel

Iprscan IPR000891 [PF00682]

20

286

Pyruvate carboxyltransferase

Iprscan IPR013709 [PF08502]

376

504

2-isopropylmalate synthase LeuA, allosteric (dimerisation) domain

Iprscan IPR005671 [TIGR00973]

11

501

Bacterial 2-isopropylmalate synthase

Iprscan IPR002034 [PS00815]

19

35

Alpha-isopropylmalate/homocitrate synthase, conserved site

Iprscan IPR002034 [PS00816]

206

219

Alpha-isopropylmalate/homocitrate synthase, conserved site

Iprscan IPR000891 [PS50991]

12

274

Pyruvate carboxyltransferase

Iprscan [seg]

355

368

-

PD327958

11

292

S=527 I=46 E=3.26576e-56

PD411944

282

352

S=213 I=59 E=3.24759e-18

PD957435

158

253

S=172 I=40 E=2.9383e-13

PDA9G1M3

12

251

S=158 I=30 E=1.64992e-11

PD002462

416

504

S=154 I=41 E=4.23062e-11

PD451739

12

184

S=135 I=26 E=9.66935e-09

PDA5J5W1

77

196

S=122 I=31 E=3.63566e-07

PD001803

12

46

S=113 I=60 E=4.10423e-06

PD829322

18

116

S=106 I=31 E=3.29766e-05

PD385158

102

157

S=105 I=41 E=3.69344e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XGR6mDvQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

146 hits
swiss-prot

Swiss-Prot ncbi-blastp

205 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBDbH_zk/XFF4834R_chr11920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.