Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr03280ilvDXFF4834R_chr03280Dihydroxy-acid dehydratase
  2. XFF4834R_chr11940ilvMXFF4834R_chr11940putative Acetolactate synthase (isozyme II), small (regulatory) subunit
  3. XFF4834R_chr11950ilvGXFF4834R_chr11950probable acetolactate synthase 2 catalytic subunit
  4. XFF4834R_chr11960ilvCXFF4834R_chr11960Ketol-acid reductoisomerase

ilvD XFF4834R_chr03280
XFF4834R_chr_0361
XFF4834R_chr_0361
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0363
XFF4834R_chr_0363
ID ilvD
AC XFF4834R_chr03280
LT XFF4834R_chr03280
OR XFF4834R_chr from 376799 to 378637 on strand -
DE Dihydroxy-acid dehydratase
IP Dihydroxy-acid/6-phosphogluconate dehydratase; Dihydroxy-acid dehydratase
CL 1.5.1.18 Isoleucine/valine GO:0009097 GO:0009099
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: branched chain family amino acid biosynthetic process (GO:0009082)
Molecular Function: dihydroxy-acid dehydratase activity (GO:0004160)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [EG] Amino acid transport and metabolism;Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 65174.5 Da
SQ 612 aa
 
........10........20........30........40........50
| | | | |
MPEYRSKTSTHGRNMAGARALWRATGMRDGDFHKPIIAIANSFTQFVPGH
VHLKDLGQLVAREIERVGGVAKEFDTIAVDDGIAMGHDGMLYSLPSREII
ADSVEYMVNAHCADALVCISNCDKITPGMLMAALRLNIPTVFVSGGPMEA
GKTKLAEHKLDLIDAMVIAADDSASDEKVAEFERSACPTCGSCSGMFTAN
SMNCLTEALGLSLPGNGTVVATHADREQLFLRAGRVAVELCHRWYGGEDP
TALPRGIATFEAFENAMTLDIAMGGSTNTILHLLAAAQEGEVAFGMRDID
RLSKRVPQLCKVAPNTPKYHIEDVHRAGGIMAILGELARGGLLHTNAATV
HARTLADAIAQWDVTQTDDENVHTFYKAGPAGIPTQIAFSQATRWDSLDT
DRSDGCIRDVAHAFSQEGGLAVLYGNIARDGCVVKTAGVDESIHVFEGNA
RVFESQDAAVKGILADEVVAGDVVVIRYEGPKGGPGMQEMLYPTSYLKSK
GLGKQCALLTDGRFSGGTSGLSIGHASPEAAAGGAIGLVREGDRILIDIP
NRSINLLISDEELALRRAEQDAKGWKPVEVRPRKVTTALKAYALLATSAD
KGAVRDKALLDG
XFF4834R

XFF4834R_chr21730 lcl|edd-XFF4834R_chr21730

35

566

S=428 I=29 E=4.77606e-45

6-phosphogluconate dehydratase

XFF4834R

XFF4834R_chr21730 lcl|edd-XFF4834R_chr21730

35

566

S=428 I=29 E=4.77606e-45

6-phosphogluconate dehydratase

pubmed

1

612

S=2317 I=71 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 3315862,3550695

 

prodomImg

pubmed

1

611

S=2311 I=71 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 7543475

 

prodomImg

pubmed

1

612

S=2308 I=70 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 2473940

 

prodomImg

pubmed

73

611

S=2131 I=76 E=0

Putative dihydroxy-acid-dehydratase ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 11728709

 

prodomImg

pubmed

1

605

S=2116 I=66 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 18408034

 

prodomImg

pubmed

1

610

S=2061 I=60 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 10555290

 

prodomImg

pubmed

1

610

S=2031 I=60 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 9516544

 

prodomImg

pubmed

1

605

S=2027 I=61 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 10555290

 

prodomImg

pubmed

1

605

S=2017 I=61 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 10555290

 

prodomImg

pubmed

1

610

S=1997 I=64 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Pubmed 10517590

 

prodomImg

sp_Pdown

sp|Q8PQI0|ILVD_XANAC

1

612

S=3159 I=97 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

sp_Pdown

sp|Q3BYS5|ILVD_XANC5

1

612

S=3130 I=96 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

sp_Pdown

sp|B0RMB4|ILVD_XANCB

1

612

S=3071 I=94 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

sp_Pdown

sp|Q5GUY8|ILVD_XANOR

1

612

S=3069 I=95 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

sp_Pdown

sp|B2SK80|ILVD_XANOP

1

612

S=3069 I=95 E=0

Dihydroxy-acid dehydratase EC=4.2.1.9 ; 4Fe-4S Amino-acid biosynthesis Branched-chain Iron Iron-sulfur Lyase Metal-binding

Iprscan IPR000581 [PTHR21000]

1

611

Dihydroxy-acid/6-phosphogluconate dehydratase

Iprscan IPR000581 [PF00920]

34

603

Dihydroxy-acid/6-phosphogluconate dehydratase

Iprscan IPR004404 [TIGR00110]

17

607

Dihydroxy-acid dehydratase

Iprscan [seg]

586

599

-

PD905529

177

429

S=557 I=49 E=6.8966e-60

PD911039

425

508

S=239 I=61 E=2.58084e-21

PD002691

509

609

S=231 I=52 E=2.18502e-20

PDA1F6M4

116

197

S=226 I=61 E=9.20935e-20

PD493476

378

428

S=216 I=76 E=1.5799e-18

PDA1W198

351

377

S=151 I=100 E=1.07872e-10

PD585030

44

114

S=148 I=47 E=2.16685e-10

PDA1F736

5

42

S=133 I=71 E=1.62237e-08

PDA4Z0O1

471

566

S=122 I=33 E=3.71111e-07

PDA1P897

351

377

S=117 I=67 E=1.52376e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0O83hTPA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

105 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr03280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr03280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr03280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr03280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ilvM XFF4834R_chr11940
XFF4834R_chr11930
XFF4834R_chr11930
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11950
XFF4834R_chr11950
ID ilvM
AC XFF4834R_chr11940
LT XFF4834R_chr11940
OR XFF4834R_chr from 1341660 to 1341917 on strand -
DE putative Acetolactate synthase (isozyme II), small (regulatory) subunit
IP
CL 1.5.1.18 Isoleucine/valine GO:0009097 GO:0009099
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 9418.8 Da
SQ 85 aa
 
........10........20........30........40........50
| | | | |
MRYRLDLVLKPAEGALVRVIGMTERRGFRPCAIQGAAAPDDAGRWHLLLD
VDSNRPPETLRLQLEKVYDCESVVITALESIEAAA
XFF4834R

YP_365312.1 lcl|XCV3581

1

85

S=436 I=99 E=8.45567e-47

putative acetolactate synthase isozyme II small subunit

XFF4834R

NP_643760.1 lcl|ilvM-XAC3453

1

85

S=436 I=99 E=8.45567e-47

acetolactate synthase isozyme II small subunit

XFF4834R

NP_638671.1 lcl|ilvM-XCC3325

1

85

S=416 I=94 E=2.0722e-44

acetolactate synthase isozyme II small subunit

XFF4834R

lcl|XALc_0757

1

80

S=300 I=70 E=2.33428e-30

putative acetolactate synthase isozyme II small subunit protein

PD274976

1

80

S=385 I=91 E=3.09682e-39

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 8v3lPavf)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11940.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11940.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11940.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ilvG XFF4834R_chr11950
XFF4834R_chr11940
XFF4834R_chr11940
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11960
XFF4834R_chr11960
ID ilvG
AC XFF4834R_chr11950
LT XFF4834R_chr11950
OR XFF4834R_chr from 1341901 to 1343622 on strand -
DE probable acetolactate synthase 2 catalytic subunit
IP TPP-binding enzymes, conserved site; Thiamine pyrophosphate enzyme, central region; Thiamine pyrophosphate enzyme, N-terminal TPP binding region
CL 1.5.1.18 Isoleucine/valine GO:0009097 GO:0009099
EC
GO InterPro
Biological Process: branched chain family amino acid biosynthetic process (GO:0009082)
Molecular Function: thiamin pyrophosphate binding (GO:0030976)
Molecular Function: magnesium ion binding (GO:0000287)
Molecular Function: transferase activity (GO:0016740)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: acetolactate synthase activity (GO:0003984)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 60748.2 Da
SQ 573 aa
 
........10........20........30........40........50
| | | | |
MNTSAHSTPRNGARWLTQALEAEGVETLFGYPGGTIMPFYDALVDSRLKH
ILVRHEQGAALAANGYARASGRVGVCVATSGPGASNLVTGIADAMLDSVP
MICLTGQVATPLLGTDAFQELDVFGMTMPIVKHSFLVRRVEELPEMVREA
FRIAREGRPGPVLIDLPKDVQVADASHLPLHVPAAVSPPPAPADAKLADA
LAAIASAERPVVYGGGGIALAGAVKAFRRFVEATGIPTALTLRGLGALPH
AHPDYLGMLGMHGTRAANMAIQECDLLVVVGARFDDRATGKLSEFAPFAR
VIHLDADAYEISKLRTADIAVPGDVAVSLKALSAARGNCQAWRTRCFANR
EKFGARYDAPGTDIYAPALLKRLSEVAPADTIIACDVGQHQMWVAQHCRF
NDPRNHLTSGALGTMGFGLPAAMGAQFACPDRTVVLVSGDGSFMMNVQEL
VTIARCKLPVKIVLLDNSSLGMVRQWQELFFAERYSEIDLSDNPDFAALA
QVFGIPAKRIIARGDVDAALAELLAQPGPGLLHVAIDARANVWPLVPPNN
ANSTMLDSNPAHAAKETSHALPA
XFF4834R

XFF4834R_chr01950 lcl|poxB-XFF4834R_chr01950

10

536

S=433 I=26 E=1.10473e-45

pyruvate dehydrogenase (pyruvate oxidase), thiamin-dependent, FAD-binding

XFF4834R

YP_365311.1 lcl|ilvG-XCV3580

1

573

S=2716 I=93 E=0

acetolactate synthase 2 catalytic subunit

XFF4834R

NP_643759.1 lcl|ilvG-XAC3452

1

573

S=2707 I=92 E=0

acetolactate synthase 2 catalytic subunit

XFF4834R

NP_638670.1 lcl|ilvG-XCC3324

1

573

S=2656 I=91 E=0

acetolactate synthase 2 catalytic subunit

XFF4834R

lcl|ilvG-XALc_0758

1

573

S=2432 I=80 E=0

probable acetolactate synthase isozyme II large subunit protein

XFF4834R

NP_635601.1 lcl|poxB-XCC0206

13

544

S=442 I=26 E=3.01278e-46

pyruvate dehydrogenase

XFF4834R

NP_640580.1 lcl|poxB-XAC0224

10

536

S=427 I=26 E=2.37688e-44

pyruvate dehydrogenase

XFF4834R

YP_361961.1 lcl|poxB-XCV0230

13

536

S=426 I=26 E=2.66214e-44

pyruvate dehydrogenase

pubmed

11

558

S=1573 I=55 E=0

Acetolactate synthase isozyme 2 large subunit EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain FAD Flavoprotein Magnesium Metal-binding Thia

Pubmed 3550695,1379743

 

prodomImg

pubmed

1

556

S=1216 I=43 E=2.28335e-138

Acetohydroxy acid synthase large subunit EC=4.1.3.18 ; Lyase

Pubmed 14702326

 

prodomImg

pubmed

11

560

S=1195 I=44 E=8.42992e-136

Acetolactate synthase large subunit EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain FAD Flavoprotein Magnesium Metal-binding Thiamine pyroph

Pubmed 8969504

 

prodomImg

pubmed

1

556

S=1166 I=43 E=2.27194e-132

Acetolactate synthase isozyme 1 large subunit EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain FAD Flavoprotein Magnesium Metal-binding Thia

Pubmed 2989782,2989781

 

prodomImg

pubmed

10

556

S=1158 I=42 E=2.58721e-131

Acetolactate synthase EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain Chloroplast Magnesium Metal-binding Plastid Thiamine pyrophosphate Transfera

Pubmed 17522086

 

prodomImg

pubmed

12

559

S=1142 I=42 E=2.16958e-129

Acetolactate synthase large subunit EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain Chloroplast FAD Flavoprotein Magnesium Metal-binding Plastid Th

Pubmed 9929392

 

prodomImg

pubmed

11

556

S=1132 I=42 E=3.23738e-128

Acetolactate synthase EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain Lyase Magnesium Metal-binding Thiamine pyrophosphate Transferase

Pubmed 10430574

 

prodomImg

pubmed

1

556

S=1131 I=40 E=4.20522e-128

Acetolactate synthase large subunit EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain Chloroplast FAD Flavoprotein Magnesium Metal-binding Plastid T

Pubmed 11040290

 

prodomImg

pubmed

11

556

S=1130 I=43 E=5.75576e-128

Acetolactate synthase EC=4.1.3.18 ; Lyase

Pubmed 8206855

 

prodomImg

pubmed

1

556

S=1128 I=42 E=1.03228e-127

Acetohydroxy acid synthase (AHAS) EC=4.1.3.18 ; Lyase

Pubmed 1512571

 

prodomImg

sp_Pdown

sp|P00892|ILVG_ECOLI

11

558

S=1573 I=55 E=0

Acetolactate synthase isozyme 2 large subunit EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain FAD Flavoprotein Magnesium Metal-binding Thia

sp_Pdown

sp|Q7U5G1|ILVB_SYNPX

11

567

S=1206 I=46 E=2.47011e-137

Acetolactate synthase large subunit EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain FAD Flavoprotein Magnesium Metal-binding Thiamine pyrophosphate

sp_Pdown

sp|Q57725|ILVB_METJA

11

548

S=1196 I=45 E=4.20079e-136

Probable acetolactate synthase large subunit EC=2.2.1.6 ; Amino-acid biosynthesis Branched-chain FAD Flavoprotein Magnesium Metal-binding Thiamine pyro

Iprscan [G3DSA:3.40.50.970]

10

193

-

Iprscan [G3DSA:3.40.50.970]

337

539

-

Iprscan IPR012001 [PF02776]

10

179

Thiamine pyrophosphate enzyme, N-terminal TPP binding region

Iprscan IPR012000 [PF00205]

197

332

Thiamine pyrophosphate enzyme, central region

Iprscan IPR011766 [PF02775]

386

534

Thiamine pyrophosphate enzyme, C-terminal TPP-binding

Iprscan IPR012846 [TIGR00118]

10

559

Acetolactate synthase, large subunit, biosynthetic

Iprscan IPR000399 [PS00187]

423

442

TPP-binding enzymes, conserved site

Iprscan [seg]

58

71

-

Iprscan [seg]

183

207

-

PD000376

7

170

S=465 I=54 E=7.60156e-49

PD000397

369

545

S=418 I=48 E=3.73267e-43

PDA1L2K9

328

372

S=214 I=84 E=2.16652e-18

PDA2U0C6

497

541

S=202 I=93 E=7.21004e-17

PDA9H1G9

209

475

S=191 I=24 E=1.51157e-15

PD587410

262

331

S=178 I=53 E=4.49136e-14

PD653389

135

287

S=167 I=32 E=1.07316e-12

PD874816

542

573

S=160 I=97 E=7.49992e-12

PDA81339

256

311

S=131 I=46 E=2.42743e-08

PD875365

495

556

S=126 I=44 E=1.03206e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KFFLQIqd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

218 hits
swiss-prot

Swiss-Prot ncbi-blastp

130 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11950.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11950.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11950.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
ilvC XFF4834R_chr11960
XFF4834R_chr11950
XFF4834R_chr11950
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_1281
XFF4834R_chr_1281
ID ilvC
AC XFF4834R_chr11960
LT XFF4834R_chr11960
OR XFF4834R_chr from 1343666 to 1344667 on strand -
DE Ketol-acid reductoisomerase
IP Acetohydroxy acid isomeroreductase C-terminal; NAD(P)-binding domain
CL 1.5.1.18 Isoleucine/valine GO:0009097 GO:0009099
EC
GO InterPro
Biological Process: branched chain family amino acid biosynthetic process (GO:0009082)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: cellular amino acid biosynthetic process (GO:0008652)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: ketol-acid reductoisomerase activity (GO:0004455)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by darrasse (20120326)
MW 35994.7 Da
SQ 333 aa
 
........10........20........30........40........50
| | | | |
MSNDTQPKIAIIGYGSQGRAHALNLRDSGFDVTVGLRAGGPTEAKAQADG
FTVVAPSEAVKSADLVAILTPDMVQKRLYEEVIAPNMKQGACLLFAHGLN
VHFDMIKPRADLDVVLVAPKGPGALVRREYEIGRGVPCIYAVYQDTSGKA
EQFALTYAGGLGGARANIIKTTFKEETETDLFGEQAVLCGGASSLVQAGF
EVLVEAGYQPEIAYYEVLHELKLIVDLFYEGGITRMLEFVSETAQYGDYV
SGPRVIDAGTKARMKDVLTDIQNGTFTKNWVAEYDAGLPNYNKFKQADLE
HPIEEVGKKLRAKMVWLNGQQQAAAAPANQQAA
pubmed

8

318

S=998 I=60 E=3.13772e-112

Ketol-acid reductioisomerase ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 10708373,8990292

 

prodomImg

pubmed

8

318

S=977 I=59 E=1.05248e-109

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 8529876

 

prodomImg

pubmed

8

318

S=934 I=58 E=1.72278e-104

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 19014707

 

prodomImg

pubmed

8

317

S=915 I=56 E=3.67224e-102

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 1744032

 

prodomImg

pubmed

9

316

S=915 I=56 E=3.67224e-102

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 18408034

 

prodomImg

pubmed

1

318

S=913 I=55 E=5.53219e-102

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 18700039

 

prodomImg

pubmed

8

318

S=913 I=54 E=6.47223e-102

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 8921849

 

prodomImg

pubmed

9

318

S=911 I=55 E=1.121e-101

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 1903397

 

prodomImg

pubmed

9

318

S=900 I=55 E=2.08009e-100

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 8969504

 

prodomImg

pubmed

6

317

S=899 I=57 E=3.07947e-100

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Pubmed 19077236

 

prodomImg

sp_Pdown

sp|Q3BPK3|ILVC_XANC5

1

319

S=1619 I=96 E=0

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

sp_Pdown

sp|Q8PH09|ILVC_XANAC

1

319

S=1607 I=96 E=0

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

sp_Pdown

sp|Q8P5L5|ILVC_XANCP

1

319

S=1598 I=94 E=0

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

sp_Pdown

sp|B0RP32|ILVC_XANCB

1

319

S=1598 I=94 E=0

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

sp_Pdown

sp|Q4UYF7|ILVC_XANC8

1

319

S=1598 I=94 E=0

Ketol-acid reductoisomerase EC=1.1.1.86 ; Amino-acid biosynthesis Branched-chain NADP Oxidoreductase

Iprscan IPR016040 [G3DSA:3.40.50.720]

7

171

NAD(P)-binding domain

Iprscan [PTHR21371:SF1]

69

326

-

Iprscan IPR013023 [PTHR21371]

69

326

Acetohydroxy acid isomeroreductase

Iprscan IPR013116 [PF07991]

8

166

Acetohydroxy acid isomeroreductase, catalytic

Iprscan IPR000506 [PF01450]

173

317

Acetohydroxy acid isomeroreductase C-terminal

Iprscan IPR013023 [TIGR00465]

4

318

Acetohydroxy acid isomeroreductase

Iprscan [seg]

170

179

-

Iprscan [seg]

320

333

-

PD132213

208

316

S=367 I=61 E=5.58868e-37

PD781231

1

71

S=221 I=61 E=2.7889e-19

PD002380

123

207

S=216 I=55 E=1.0224e-18

PDA1F706

72

122

S=170 I=57 E=4.25399e-13

Iprscan IPR008927 [SSF48179]

173

322

6-phosphogluconate dehydrogenase, C-terminal-like

Iprscan IPR016040 [SSF51735]

7

170

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AjNRdYRG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

61 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRH3P7p/XFF4834R_chr11960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.