Xanthomonas fuscans subsp. fuscans

8 hits

  1. XFF4834R_chr04650trpEXFF4834R_chr04650probable anthranilate synthase component I
  2. XFF4834R_chr04770trpGXFF4834R_chr04770probable anthranilate synthase component II
  3. XFF4834R_chr04790trpDXFF4834R_chr04790putative anthranilate phosphoribosyl transferase
  4. XFF4834R_chr04800trpCXFF4834R_chr04800indole-3-glycerolphosphate synthetase
  5. XFF4834R_chr09420wrbAXFF4834R_chr09420putative flavoprotein WrbA (Trp repressor binding protein)
  6. XFF4834R_chr27120trpAXFF4834R_chr27120probable tryptophan synthase subunit alpha
  7. XFF4834R_chr27140trpBXFF4834R_chr27140probable tryptophan synthase subunit beta
  8. XFF4834R_chr27160trpFXFF4834R_chr27160probable N-(5'-phosphoribosyl)anthranilate isomerase

trpE XFF4834R_chr04650
XFF4834R_chr_0515
XFF4834R_chr_0515
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04660
XFF4834R_chr04660
ID trpE
AC XFF4834R_chr04650
LT XFF4834R_chr04650
OR XFF4834R_chr from 533041 to 534516 on strand +
DE probable anthranilate synthase component I
IP Anthranilate synthase component I; Anthranilate synthase, clad 3; Chorismate binding, C-terminal
CL 1.5.1.15 Tryptophan GO:0000162
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Biological Process: tryptophan biosynthetic process (GO:0000162)
Molecular Function: anthranilate synthase activity (GO:0004049)
Molecular Function: oxo-acid-lyase activity (GO:0016833)

Curated
PM
AN
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by darrasse (20110304)
MW 54191 Da
SQ 491 aa
 
........10........20........30........40........50
| | | | |
MITAEQFQRQAAEGHTRIPVVREVLSDLDTPLSVYLKLADGAYTYLFESV
EGGERFGRYSIIGLPARRVYSFRARTLEVSEHGEVVETREVADPLAEVDA
LRAEHSVPQLEGLPGFTGGLVGWFGFECIQYIEPRLGSGDKPDELGTPDI
LLMLSEELAVFDNLKGRLYLIVHADPRQPQAYVRANRRLDELAHRLRQGG
AGYPQAQISDAIDEADFHSSFAREEYHAVVRKAQEYVRAGDIFQVVPSQR
LRVPFRARPVDVYRALRALNPSPYMYFLDVGGTQVVGSSPEILARLRDGV
VTVRPIAGTRPRGATPELDKALEAELLADPKERAEHVMLIDLGRNDVGRV
AEPGTVKVGEQFVIERYSHVMHIVSEVTGTLKAGLNYSDVLRATFPAGTV
SGAPKIRALEIIRELEPVKRNVYSGAVGYIGWHGDADTAIAIRTAVIQDG
YLYVQAGGGVVYDSDPDLEWQETMNKGRALFRAVAQAAKGL
XFF4834R

XFF4834R_chr11230 lcl|XFF4834R_chr11690667_1255022_f3_XFF4834R-XFF4834R_chr11230

18

486

S=507 I=34 E=9.78424e-55

XFF4834R

NP_640831.1 lcl|trpE-XAC0476

1

491

S=2427 I=96 E=0

anthranilate synthase component I

XFF4834R

YP_362236.1 lcl|trpE-XCV0505

1

491

S=2421 I=96 E=0

anthranilate synthase component I

XFF4834R

NP_635853.1 lcl|trpE-XCC0459

1

491

S=2420 I=95 E=0

anthranilate synthase component I

XFF4834R

lcl|trpE-XALc_0279

1

491

S=1902 I=75 E=0

probable anthranilate synthase componentIprotein

XFF4834R

NP_641467.1 lcl|trpE-XAC1130

18

486

S=527 I=34 E=1.4838e-56

hypothetical protein

XFF4834R

YP_362880.1 lcl|trpE-XCV1149

20

486

S=524 I=34 E=3.14061e-56

hypothetical protein

XFF4834R

lcl|XALc_0629

230

484

S=499 I=44 E=3.69717e-53

putative anthranilate synthase componentIprotein

XFF4834R

NP_636397.1 lcl|trpE-XCC1021

224

487

S=487 I=43 E=1.00683e-51

hypothetical protein

XFF4834R

lcl|albXVII-XALc_1519

95

484

S=443 I=30 E=2.43986e-46

putative para-aminobenzoate synthase;albicidin synthetase protein

pubmed

2

480

S=1411 I=57 E=4.03564e-162

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 1987141

 

prodomImg

pubmed

2

489

S=1379 I=55 E=3.34923e-158

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 2404959

 

prodomImg

pubmed

2

491

S=1364 I=56 E=2.20023e-156

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 2105306

 

prodomImg

pubmed

1

491

S=1314 I=53 E=2.60628e-150

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 10417653

 

prodomImg

pubmed

1

491

S=1307 I=53 E=1.93605e-149

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 10417653

 

prodomImg

pubmed

2

491

S=1285 I=53 E=8.00557e-147

Anthranilate synthase component I

Pubmed 12754231

 

prodomImg

pubmed

1

491

S=1266 I=53 E=1.78248e-144

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 10417653

 

prodomImg

pubmed

1

491

S=1266 I=53 E=1.78248e-144

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 10417653

 

prodomImg

pubmed

1

491

S=1193 I=48 E=1.06695e-135

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Pubmed 2338941

 

prodomImg

pubmed

2

491

S=1178 I=52 E=7.58133e-134

Anthranilate synthase component I EC=4.1.3.27 Anthranilate synthase large subunit EC=4.1.3.27 ; Lyase

Pubmed 12694904

 

prodomImg

sp_Pdown

sp|P21689|TRPE_PSESS

2

480

S=1411 I=57 E=2.77616e-162

Anthranilate synthase component 1 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Lyase Tryptophan

Iprscan IPR005801 [G3DSA:3.60.120.10]

11

484

ADC synthase

Iprscan IPR006805 [PF04715]

20

170

Anthranilate synthase component I, N-terminal

Iprscan IPR015890 [PF00425]

222

484

Chorismate binding, C-terminal

Iprscan IPR005256 [TIGR00564]

26

485

Anthranilate synthase component I

Iprscan [seg]

316

332

-

PD000779

106

487

S=927 I=48 E=1.0674e-104

PD176622

117

171

S=221 I=67 E=3.14282e-19

PD875326

75

116

S=177 I=81 E=7.68274e-14

PDA694X9

117

147

S=170 I=97 E=4.51e-13

PDA0Y7I6

169

214

S=166 I=67 E=1.74215e-12

PDA1T917

1

28

S=142 I=100 E=1.36137e-09

PDA078Y1

21

175

S=135 I=29 E=9.76618e-09

PD820588

172

241

S=126 I=44 E=9.50611e-08

PD105823

29

69

S=126 I=61 E=1.17187e-07

PDA2N0A9

389

444

S=106 I=39 E=2.79772e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one GgGBMqgZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

182 hits
swiss-prot

Swiss-Prot ncbi-blastp

95 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04650.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04650.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04650.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
trpG XFF4834R_chr04770
XFF4834R_chr04760
XFF4834R_chr04760
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04780
XFF4834R_chr04780
ID trpG
AC XFF4834R_chr04770
LT XFF4834R_chr04770
OR XFF4834R_chr from 544145 to 544723 on strand +
DE probable anthranilate synthase component II
IP Glutamine amidotransferase class-I, C-terminal; Carbamoyl phosphate synthase, GATase region; Anthranilate synthase component II/delta crystallin; Glutamine amidotransferase of anthranilate synthase
CL 1.5.1.15 Tryptophan GO:0000162
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Biological Process: metabolic process (GO:0008152)
Biological Process: glutamine metabolic process (GO:0006541)
Molecular Function: anthranilate synthase activity (GO:0004049)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN interpro domains and pubmed hit correspond to a probable anthranilate synthase component II, which is encoded by a trpG gene in Pseudomonas. In E. coli trpGD is a fused fused glutamine amidotransferase (component II) of anthranilate synthase -!- anthranilate phosphoribosyl transferase, furthermore the gene pabA shares high homology with XFF4834R_chr04770 but does not have the same function (aminodeoxychorismate synthase, subunit II). A comparison of the nucleotide and amino acid sequences of pabA and trp(G) D reveals extensive homology, suggesting that these two genes arose from a common ancestor. pabA and trp(G) D are 44% homologous at the amino acid level and 53% homologous at the nucleotide sequence level. The nucleotide sequences can be divided into regions of high homology, in which most nucleotide changes occur in the third position of codons and do not effect the amino acid sequence, and regions which show almost no DNA homology. Divergence in these non-homologous regions appears to have resulted from single-base substitutions as well as the rearrangement of small regions of DNA by inversion, deletion and duplication.
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: acur
CC STATUS: curated by darrasse (20120321)
MW 21102 Da
SQ 192 aa
 
........10........20........30........40........50
| | | | |
MLLMLDNYDSFTYNLVQYLQALGAEVTVVRNDAMSVDQIAALKPERIVIS
PGPCTPNEAGISLQLIERLGQTTPILGVCLGHQSIGQVYGGDVIRAGNIM
HGKTSPIRHQGKGVFAGLPDSYEATRYHSLVVDKTTLPDALEVTAWTENP
DGSMEEIMGLRHRQFPVEGVQFHPESILTQHGHALLKNFLQR
XFF4834R

XFF4834R_chr20060 lcl|carA-XFF4834R_chr20060

8

176

S=142 I=28 E=5.69001e-11

carbamoyl phosphate synthetase small subunit, glutamine amidotransferase

XFF4834R

XFF4834R_chr22900 lcl|guaA-XFF4834R_chr22900

2

190

S=123 I=26 E=9.66862e-09

GMP synthetase (glutamine aminotransferase)

XFF4834R

XFF4834R_chr20060 lcl|carA-XFF4834R_chr20060

8

176

S=142 I=28 E=5.69001e-11

carbamoyl phosphate synthetase small subunit, glutamine amidotransferase

XFF4834R

XFF4834R_chr22900 lcl|guaA-XFF4834R_chr22900

2

190

S=123 I=26 E=9.66862e-09

GMP synthetase (glutamine aminotransferase)

pubmed

1

192

S=729 I=69 E=5.30408e-80

Anthranilate synthase component II EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Glutamine amidotransferase Lyase Tryptophan

Pubmed 2105306

 

prodomImg

pubmed

1

192

S=706 I=66 E=3.05473e-77

Anthranilate synthase component II EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Glutamine amidotransferase Lyase Tryptophan

Pubmed 2404959,659439

 

prodomImg

pubmed

1

192

S=658 I=61 E=2.00007e-71

Para-aminobenzoate synthase glutamine amidotransferase component II EC=2.6.1.85 ; Folate biosynthesis

Pubmed 3894673,2403545

 

prodomImg

pubmed

1

192

S=648 I=64 E=3.37188e-70

Glutamine amidotransferase

Pubmed 18291316,17400768

 

prodomImg

pubmed

1

191

S=647 I=58 E=4.496e-70

Anthranilate synthase component 2 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Glutamine amidotransferase Lyase Tryptophan

Pubmed 6599977

 

prodomImg

pubmed

1

192

S=645 I=62 E=6.54103e-70

Para-aminobenzoate synthase glutamine amidotransferase component II EC=2.6.1.85 ; Folate biosynthesis

Pubmed 3894673

 

prodomImg

pubmed

1

192

S=638 I=61 E=5.98989e-69

Para-aminobenzoate synthase glutamine amidotransferase component II EC=2.6.1.85 ; Folate biosynthesis

Pubmed 6350604,2403545

 

prodomImg

pubmed

1

192

S=615 I=60 E=3.33146e-66

Para-aminobenzoate synthase glutamine amidotransferase component II EC=2.6.1.85 ; Folate biosynthesis

Pubmed 3894673

 

prodomImg

pubmed

1

190

S=610 I=60 E=1.15906e-65

Anthranilate synthase component II

Pubmed 10511537

 

prodomImg

pubmed

1

192

S=610 I=58 E=1.36788e-65

Anthranilate synthase component II

Pubmed 12754231

 

prodomImg

sp_Pdown

sp|P20576|TRPG_PSEAE

1

192

S=729 I=69 E=3.6768e-80

Anthranilate synthase component II EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Glutamine amidotransferase Lyase Tryptophan

sp_Pdown

sp|P00901|TRPG_PSEPU

1

192

S=706 I=66 E=2.11754e-77

Anthranilate synthase component II EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Glutamine amidotransferase Lyase Tryptophan

sp_Pdown

sp|P06193|PABA_SALTY

1

192

S=658 I=61 E=1.38645e-71

Para-aminobenzoate synthase glutamine amidotransferase component II EC=2.6.1.85 ; Folate biosynthesis

sp_Pdown

sp|P00902|TRPG_ACIAD

1

191

S=647 I=58 E=3.11664e-70

Anthranilate synthase component 2 EC=4.1.3.27 ; Amino-acid biosynthesis Aromatic Glutamine amidotransferase Lyase Tryptophan

sp_Pdown

sp|P06195|PABA_SERMA

1

192

S=645 I=62 E=4.53426e-70

Para-aminobenzoate synthase glutamine amidotransferase component II EC=2.6.1.85 ; Folate biosynthesis

Iprscan IPR006220 [PR00097]

2

16

Anthranilate synthase component II/delta crystallin

Iprscan IPR006220 [PR00097]

47

56

Anthranilate synthase component II/delta crystallin

Iprscan IPR006220 [PR00097]

74

85

Anthranilate synthase component II/delta crystallin

Iprscan IPR006220 [PR00097]

99

107

Anthranilate synthase component II/delta crystallin

Iprscan IPR006220 [PR00097]

119

131

Anthranilate synthase component II/delta crystallin

Iprscan IPR006220 [PR00097]

169

182

Anthranilate synthase component II/delta crystallin

Iprscan IPR011702 [PR00096]

47

56

Glutamine amidotransferase superfamily

Iprscan IPR011702 [PR00096]

74

85

Glutamine amidotransferase superfamily

Iprscan IPR011702 [PR00096]

169

182

Glutamine amidotransferase superfamily

Iprscan IPR001317 [PR00099]

44

58

Carbamoyl phosphate synthase, GATase domain

Iprscan IPR001317 [PR00099]

74

90

Carbamoyl phosphate synthase, GATase domain

Iprscan [G3DSA:3.40.50.880]

2

190

-

Iprscan [PTHR11922]

1

192

-

Iprscan IPR000991 [PF00117]

4

190

Glutamine amidotransferase class-I, C-terminal

Iprscan IPR006221 [TIGR00566]

1

192

Glutamine amidotransferase of anthranilate synthase

PD095787

127

192

S=185 I=54 E=6.61442e-15

PD095731

74

133

S=173 I=51 E=1.81704e-13

PD629602

1

58

S=151 I=52 E=7.25593e-11

PDA1F790

28

63

S=145 I=69 E=4.11346e-10

PD002064

1

28

S=123 I=82 E=1.92173e-07

PDA1U3F9

105

131

S=109 I=74 E=9.88994e-06

PD689301

105

131

S=106 I=67 E=2.34454e-05

PDA5I8P3

109

147

S=102 I=49 E=6.50248e-05

Iprscan [SSF52317]

1

191

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nkGUhlej)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

327 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

16 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04770.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04770.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04770.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
trpD XFF4834R_chr04790
XFF4834R_chr04780
XFF4834R_chr04780
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04800
XFF4834R_chr04800
ID trpD
AC XFF4834R_chr04790
LT XFF4834R_chr04790
OR XFF4834R_chr from 545614 to 546651 on strand +
DE putative anthranilate phosphoribosyl transferase
IP Anthranilate phosphoribosyl transferase; AMP phosphorylase
CL 1.5.1.15 Tryptophan GO:0000162
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: tryptophan biosynthetic process (GO:0000162)
Molecular Function: anthranilate phosphoribosyltransferase activity (GO:0004048)
transferring glycosyl groups (GO:0016757)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120319)
MW 36610.8 Da
SQ 345 aa
 
........10........20........30........40........50
| | | | |
MPITPQEALQRTIEHREIFHDEMVELMRQIMRGEVSDMMVAAILTGLRVK
KETIGEIAGAATVMREFSRRVDVADRQHMVDIVGTGGDGSHTFNISTCAM
FVAAAGGANVAKHGNRSVSSKSGSADALEALGAVIELQPEQVASALAHTG
IGFMYAPVHHPAMKVVAPVRREMGVRTIFNILGPLTNPAGSPNILMGVFH
PDLVGIQARVLQELGAERALVVWGRDGMDELSLGAGTLVGELRDGQVREY
EVHPEDFGIAMSASRNLKVADAAQSRAMLLQVLDNVPGPALDIVALNAGA
ALYVAGIADSIADGVLRARAVIADGSARARVDAYIAYTRQLAVQP
Hamap TRPD_MF_00211 raw_score=6670 norm_score=36.383

Anthranilate phosphoribosyltransferase [trpD].

XFF4834R

NP_640835.1 lcl|trpD-XAC0480

1

345

S=1770 I=99 E=0

anthranilate phosphoribosyltransferase

XFF4834R

YP_362247.1 lcl|trpD-XCV0516

1

344

S=1691 I=98 E=0

anthranilate phosphoribosyltransferase

XFF4834R

NP_635863.1 lcl|trpD-XCC0469

1

344

S=1616 I=92 E=0

anthranilate phosphoribosyltransferase

XFF4834R

lcl|trpD-XALc_0282

1

341

S=1464 I=88 E=3.17322e-170

probable anthranilate phosphoribosyltransferase protein

pubmed

1

341

S=1310 I=73 E=5.49786e-150

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 12754231

 

prodomImg

pubmed

8

338

S=745 I=48 E=1.26402e-81

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 2105306

 

prodomImg

pubmed

6

341

S=740 I=44 E=5.81291e-81

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 6599977

 

prodomImg

pubmed

6

339

S=727 I=44 E=1.96853e-79

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 17563350

 

prodomImg

pubmed

6

344

S=720 I=45 E=1.47511e-78

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 2404959

 

prodomImg

pubmed

17

339

S=671 I=45 E=1.19062e-72

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 9061023

 

prodomImg

pubmed

9

322

S=646 I=44 E=1.27343e-69

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 10369778

 

prodomImg

pubmed

9

332

S=632 I=42 E=7.46919e-68

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 3924737,6425119

 

prodomImg

pubmed

6

335

S=632 I=41 E=7.73428e-68

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 18391199

 

prodomImg

pubmed

6

324

S=627 I=44 E=2.64434e-67

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Pubmed 2113923

 

prodomImg

sp_Pdown

sp|Q8PQ48|TRPD_XANAC

1

345

S=1770 I=99 E=0

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

sp_Pdown

sp|Q3BYB6|TRPD_XANC5

1

344

S=1691 I=98 E=0

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

sp_Pdown

sp|B2SL02|TRPD_XANOP

1

345

S=1652 I=95 E=0

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

sp_Pdown

sp|Q2NYD6|TRPD_XANOM

1

345

S=1652 I=95 E=0

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

sp_Pdown

sp|Q8PD71|TRPD_XANCP

1

344

S=1616 I=92 E=0

Anthranilate phosphoribosyltransferase EC=2.4.2.18 ; Amino-acid biosynthesis Aromatic Glycosyltransferase Tryptophan

Iprscan IPR000312 [G3DSA:3.40.1030.10]

74

340

Glycosyl transferase, family 3

Iprscan IPR005940 [MF_00211]

7

337

Anthranilate phosphoribosyl transferase

Iprscan IPR017459 [PF02885]

4

69

Glycosyl transferase, family 3, N-terminal

Iprscan IPR000312 [PF00591]

76

328

Glycosyl transferase, family 3

Iprscan IPR005940 [TIGR01245]

9

337

Anthranilate phosphoribosyl transferase

PD001864

79

344

S=556 I=49 E=7.58774e-60

PDA2S2L8

128

271

S=152 I=29 E=6.61744e-11

PD571708

15

73

S=138 I=53 E=2.76257e-09

PDA6M9J1

1

21

S=116 I=100 E=1.26831e-06

PD667263

267

341

S=113 I=38 E=3.57949e-06

PDA2Y7R5

1

21

S=108 I=95 E=1.23454e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eNnfx91d)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

48 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04790.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04790.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
trpC XFF4834R_chr04800
XFF4834R_chr04790
XFF4834R_chr04790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04810
XFF4834R_chr04810
ID trpC
AC XFF4834R_chr04800
LT XFF4834R_chr04800
OR XFF4834R_chr from 546792 to 547589 on strand +
DE indole-3-glycerolphosphate synthetase
IP Aldolase-type TIM barrel; Indole-3-glycerol phosphate synthase
CL 1.5.1.15 Tryptophan GO:0000162
EC
GO InterPro
Biological Process: tryptophan metabolic process (GO:0006568)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: indole-3-glycerol-phosphate synthase activity (GO:0004425)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120319)
MW 28795.6 Da
SQ 265 aa
 
........10........20........30........40........50
| | | | |
MSDILNTILARKADEVAERSARVPLAELIARSADLPLTRGFAAAMQASIA
AGDPAVIAEVKKASPSKGVIRPDFQPADIAVSYEFGGATCLSVLTDVDFF
QGSDAYLRQARDACTLPVLRKDFTVDPYQVYEARVLGADCILLIVSALED
AQLADLSGLAMQLGLDVLVEVHDIDELERAVQVPVPLIGINNRNLRTFEV
TLQTTLDMRAAVPRDRVLVTESGIVTQADVQRMRSHDVNAFLVGETFMRA
AEPGESLRQLFFAHD
XFF4834R

NP_640836.1 trpC-XAC0481

1

265

S=1362 I=100 E=4.58561e-158

indole-3-glycerol-phosphate synthase

XFF4834R

YP_362248.1 trpC-XCV0517

1

265

S=1357 I=100 E=1.65201e-157

indole-3-glycerol-phosphate synthase

XFF4834R

NP_635864.1 trpC-XCC0470

1

265

S=1227 I=92 E=1.05411e-141

indole-3-glycerol-phosphate synthase

XFF4834R

XALc_0283 trpC-XALc_0283

1

263

S=1071 I=80 E=8.34318e-123

probable indole-3-glycerol phosphate synthase protein

pubmed

4

262

S=854 I=65 E=6.72241e-95

Indole-3-glycerol phosphate synthase EC=4.1.1.48 ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

Pubmed 2105306

 

prodomImg

pubmed

4

262

S=849 I=65 E=2.76019e-94

Indole-3-glycerol phosphate synthase EC=4.1.1.48 ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

Pubmed 2404959

 

prodomImg

pubmed

4

261

S=736 I=56 E=1.22322e-80

Putative indole-3-glycerol phosphate synthase ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

Pubmed 19270136

 

prodomImg

pubmed

1

262

S=695 I=58 E=1.31755e-75

Indole-3-glycerol phosphate synthase ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

Pubmed 12754231

 

prodomImg

pubmed

4

261

S=685 I=53 E=1.80185e-74

Indole-3-glycerol phosphate synthase EC=4.1.1.48 ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

Pubmed 6599977

 

prodomImg

sp_Pdown

sp|Q8PQ47|TRPC_XANAC

1

265

S=1362 I=100 E=1.28078e-156

Indole-3-glycerol phosphate synthase EC=4.1.1.48 ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

sp_Pdown

sp|Q3BYB5|TRPC_XANC5

1

265

S=1357 I=100 E=4.61416e-156

Indole-3-glycerol phosphate synthase EC=4.1.1.48 ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

sp_Pdown

sp|B2SL03|TRPC_XANOP

1

265

S=1342 I=98 E=3.45472e-154

Indole-3-glycerol phosphate synthase EC=4.1.1.48 ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

sp_Pdown

sp|Q2NYD7|TRPC_XANOM

1

265

S=1339 I=98 E=8.33392e-154

Indole-3-glycerol phosphate synthase EC=4.1.1.48 ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

sp_Pdown

sp|Q8PD70|TRPC_XANCP

1

265

S=1227 I=92 E=2.94418e-140

Indole-3-glycerol phosphate synthase EC=4.1.1.48 ; Amino-acid biosynthesis Aromatic Decarboxylase Lyase Tryptophan

Iprscan IPR013785 [G3DSA:3.20.20.70]

1

265

Aldolase-type TIM barrel

Iprscan [PTHR22854:SF2]

3

264

-

Iprscan [PTHR22854]

3

264

-

Iprscan IPR013798 [PF00218]

4

260

Indole-3-glycerol phosphate synthase

Iprscan IPR001468 [PS00614]

56

74

Indole-3-glycerol phosphate synthase, conserved site

PD001511

17

208

S=549 I=61 E=5.29006e-59

PD551789

210

262

S=149 I=51 E=1.36122e-10

PD240700

1

103

S=149 I=41 E=1.60646e-10

PD812597

191

260

S=137 I=44 E=4.45174e-09

PDA1V842

191

260

S=132 I=39 E=1.76521e-08

PDA1F8L7

176

209

S=129 I=71 E=3.67167e-08

PDA1V840

1

36

S=109 I=64 E=9.07684e-06

Iprscan IPR011060 [SSF51366]

11

265

Ribulose-phosphate binding barrel

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one XUYt7ATG)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

113 hits
swiss-prot

Swiss-Prot ncbi-blastp

404 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr04800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
wrbA XFF4834R_chr09420
XFF4834R_chr09410
XFF4834R_chr09410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09430
XFF4834R_chr09430
ID wrbA
AC XFF4834R_chr09420
LT XFF4834R_chr09420
OR XFF4834R_chr from 1083593 to 1084189 on strand -
DE putative flavoprotein WrbA (Trp repressor binding protein)
IP Flavoprotein WrbA
CL 1.5.1.15 Tryptophan GO:0000162
EC
GO InterPro
Biological Process: negative regulation of transcription (GO:0016481)
Molecular Function: FMN binding (GO:0010181)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100504)
MW 20343 Da
SQ 198 aa
 
........10........20........30........40........50
| | | | |
MAEILVLYYSRGGSVARLARQIARGIGEVPGMGARLRTVPPVAAVTQTSA
PPVPDEGAPYVDRADLAECNGLLLGSPTRFGNMAAPMKHFLDSLGAEWAS
GTLAGKPAGVFTSTASMHGGQESTLLSMHLPLLHHGCLIVGIPFTEAALS
HTTSGGTPYGASHVSGAGGDPQPSEDEALLARALGRRVADIARRLATP
XFF4834R

XFF4834R_chr36060 lcl|XFF4834R_chr39210420_4175989_f2_XFF4834R-XFF4834R_chr36060

1

141

S=99 I=26 E=9.10001e-06

XFF4834R

XFF4834R_chr36060 lcl|XFF4834R_chr39210420_4175989_f2_XFF4834R-XFF4834R_chr36060

1

141

S=99 I=26 E=9.10001e-06

XFF4834R

NP_641288.1 lcl|XAC0936-XAC0936

1

198

S=945 I=93 E=1.14629e-107

tryptophan repressor binding protein

XFF4834R

YP_362698.1 lcl|wrbA-XCV0967

1

198

S=937 I=92 E=1.0497e-106

flavoprotein WrbA (Trp repressor binding protein)

XFF4834R

NP_636250.1 lcl|XCC0859

1

198

S=908 I=89 E=3.22431e-103

tryptophan repressor binding protein

XFF4834R

lcl|wrbA-XALc_0479

1

196

S=793 I=80 E=3.02441e-89

probable flavoprotein wrba (trp repressor binding protein)

XFF4834R

NP_642549.1 lcl|XAC2232-XAC2232

2

177

S=160 I=31 E=1.44928e-12

repressor binding protein

XFF4834R

lcl|XALc_2956

66

141

S=104 I=32 E=7.17289e-06

putative flavodoxin protein

XFF4834R

NP_644016.2 lcl|wrbA-XAC3709

1

141

S=101 I=26 E=1.93801e-05

tryptophan repressor binding protein

XFF4834R

YP_365560.1 lcl|XCV3829

1

141

S=99 I=26 E=2.99696e-05

flavodoxin

XFF4834R

NP_639014.2 lcl|wrbA-XCC3668

1

141

S=97 I=27 E=5.66365e-05

tryptophan repressor binding protein

pubmed

1

196

S=718 I=75 E=1.18903e-78

WrbA

Pubmed 19218412

 

prodomImg

pubmed

1

196

S=709 I=74 E=1.47738e-77

WrbA

Pubmed 19218412

 

prodomImg

pubmed

4

177

S=540 I=60 E=4.79723e-57

Trp repressor binding protein

Pubmed 18194518

 

prodomImg

pubmed

3

197

S=396 I=44 E=1.0276e-39

Para-benzoquinone reductase

Pubmed 19218392

 

prodomImg

pubmed

1

195

S=380 I=43 E=9.00122e-38

Flavoprotein wrbA ; FMN

Pubmed 19077236

 

prodomImg

pubmed

1

192

S=341 I=41 E=5.40593e-33

Flavoprotein wrbA 3 ; FMN Plasmid

Pubmed 11481432

 

prodomImg

pubmed

3

195

S=339 I=41 E=8.3598e-33

Quinone reductase 2

Pubmed 16079999

 

prodomImg

pubmed

1

195

S=331 I=35 E=8.80141e-32

AGG4 Flagellar flavodoxin ; Flagellum

Pubmed 16753570

 

prodomImg

pubmed

3

195

S=330 I=38 E=1.29169e-31

Quinone-oxidoreductase QR2

Pubmed 11260494

 

prodomImg

pubmed

1

195

S=330 I=39 E=1.32592e-31

Putative flavoprotein wrbA ; Acetylation FMN

Pubmed 10734605

 

prodomImg

sp_Pdown

sp|Q0A961|WRBA_ALHEH

1

196

S=428 I=45 E=1.13822e-43

Flavoprotein wrbA ; FMN

sp_Pdown

sp|A9AT43|WRBA_BURM1

1

197

S=422 I=44 E=5.32643e-43

Flavoprotein wrbA ; FMN

sp_Pdown

sp|B4EPK7|WRBA_BURCJ

1

197

S=419 I=44 E=1.18794e-42

Flavoprotein wrbA ; FMN

sp_Pdown

sp|A0KCF0|WRBA_BURCH

1

197

S=419 I=44 E=1.50325e-42

Flavoprotein wrbA ; FMN

sp_Pdown

sp|B1KBY1|WRBA_BURCC

1

197

S=418 I=44 E=1.72828e-42

Flavoprotein wrbA ; FMN

PD099350

81

140

S=184 I=64 E=9.02873e-15

PDA1Z1U6

36

80

S=152 I=64 E=6.74872e-11

PDA3Z049

79

103

S=134 I=100 E=9.3839e-09

PDA4X1X6

3

58

S=132 I=52 E=1.65389e-08

PDA1L8T2

130

154

S=116 I=92 E=1.2383e-06

PD769420

144

195

S=115 I=44 E=1.98288e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LAq4Piuy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

36 hits
swiss-prot

Swiss-Prot ncbi-blastp

134 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr09420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr09420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr09420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr09420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
trpA XFF4834R_chr27120
XFF4834R_chr27110
XFF4834R_chr27110
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27130
XFF4834R_chr27130
ID trpA
AC XFF4834R_chr27120
LT XFF4834R_chr27120
OR XFF4834R_chr from 3126433 to 3127239 on strand -
DE probable tryptophan synthase subunit alpha
IP Ribulose-phosphate binding barrel
CL 1.5.1.15 Tryptophan GO:0000162
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: tryptophan metabolic process (GO:0006568)
Molecular Function: tryptophan synthase activity (GO:0004834)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 27995.5 Da
SQ 268 aa
 
........10........20........30........40........50
| | | | |
MRRIDSCFAELRANGRKALIPFITAGDPSLEATVPVMHALVRAGADVIEL
GVPFSDPMADGPTIQRSSERALARGAGLAYVLEAVHEFRRDDATTPVVLM
GYLNPIEIHGTRRFAEAAVAAGVDGVLLVDLPPEEAGETRAIFTEVGLAL
IALASPTTSEQRLDMLCSTAQGYLYYVSFAGVTGASNLLDTHAASDRLRQ
LRQRAGAPVVAGFGIKDAASAAAMAVDADGVVVGSALVAALADAGEVRSA
RERAEAFLAPLRQALDQG
pubmed

1

216

S=524 I=50 E=5.53188e-55

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 19077236

 

prodomImg

pubmed

1

216

S=509 I=52 E=3.38925e-53

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 12754231

 

prodomImg

pubmed

3

216

S=469 I=46 E=2.62109e-48

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 18700039

 

prodomImg

pubmed

1

216

S=449 I=44 E=8.05777e-46

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 2503057

 

prodomImg

pubmed

3

216

S=448 I=46 E=1.0108e-45

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 11092742

 

prodomImg

pubmed

3

216

S=442 I=42 E=5.16108e-45

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 15547262

 

prodomImg

pubmed

3

216

S=432 I=44 E=7.56805e-44

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 2828322

 

prodomImg

pubmed

1

215

S=432 I=44 E=9.41124e-44

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 10511537

 

prodomImg

pubmed

1

216

S=426 I=42 E=4.48158e-43

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 3127651

 

prodomImg

pubmed

1

216

S=413 I=40 E=1.74487e-41

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Pubmed 8423001

 

prodomImg

sp_Pdown

sp|Q3BRL7|TRPA_XANC5

1

267

S=1106 I=83 E=1.23548e-125

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

sp_Pdown

sp|Q8PJ29|TRPA_XANAC

1

268

S=1098 I=82 E=1.17154e-124

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

sp_Pdown

sp|Q5GXR6|TRPA_XANOR

1

267

S=1062 I=81 E=2.91667e-120

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

sp_Pdown

sp|Q2P0U3|TRPA_XANOM

1

267

S=1062 I=81 E=2.91667e-120

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

sp_Pdown

sp|B2SVN5|TRPA_XANOP

1

267

S=1056 I=81 E=1.35305e-119

Tryptophan synthase alpha chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase

Iprscan IPR013785 [G3DSA:3.20.20.70]

1

267

Aldolase-type TIM barrel

Iprscan [PTHR10314:SF4]

54

251

-

Iprscan [PTHR10314]

54

251

-

Iprscan IPR002028 [PF00290]

8

249

Tryptophan synthase, alpha chain

Iprscan IPR002028 [TIGR00262]

8

262

Tryptophan synthase, alpha chain

Iprscan [seg]

117

131

-

Iprscan [seg]

217

244

-

PD001535

2

112

S=380 I=63 E=1.40348e-38

PD922511

179

267

S=267 I=66 E=8.43917e-25

Iprscan IPR011060 [SSF51366]

1

266

Ribulose-phosphate binding barrel

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zTRO3Xxy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

106 hits
swiss-prot

Swiss-Prot ncbi-blastp

490 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr27120.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr27120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr27120.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBwm9_9j/XFF4834R_chr27120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
trpB XFF4834R_chr27140
XFF4834R_chr27130
XFF4834R_chr27130
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27150
XFF4834R_chr27150
ID trpB
AC XFF4834R_chr27140
LT XFF4834R_chr27140
OR XFF4834R_chr from 3127708 to 3128925 on strand -
DE probable tryptophan synthase subunit beta
IP Pyridoxal phosphate-dependent enzyme, beta subunit
CL 1.5.1.15 Tryptophan GO:0000162
EC
GO InterPro
Biological Process: tryptophan metabolic process (GO:0006568)
Biological Process: metabolic process (GO:0008152)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: tryptophan synthase activity (GO:0004834)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 43192.3 Da
SQ 405 aa
 
........10........20........30........40........50
| | | | |
MSAQPISDFYAYPDAAGHFGKFGGRFVAETLIGPLQELSAAYDQARQDPS
FIAEYDKDLKHYVGRPSPIYHAERLSREVGGAQILLKREDLNHTGAHKIN
NTIGQALLASRMGKTRIIAETGAGQHGVASATVAARLGLECVVYMGATDI
ERQKINVYRMKLLGATVIPVTSGSATLKDALNEAMRDWVTNVRDTFYIIG
TVAGPDPYPRMVRDFNAIVGREAREQMLQDYGRLPDAISACVGGGSNAIG
LFHAFLNDPGVKIYGAEAAGDGIATGRHAASIAAGRPGVLHGNRTYVICD
DDGQITETHSISAGLDYPGVGPEHSFLSDSGRAVYQGITDDEAMAAFHLL
AHTEGILAALESSHAVAQSIKLARELPRDALVLCNLSGRGDKDVHTIAAR
EGIAL
XFF4834R

XFF4834R_chr11930 lcl|tdcB-XFF4834R_chr11930

59

145

S=99 I=30 E=2.41826e-05

catabolic threonine dehydratase, PLP-dependent

XFF4834R

XFF4834R_chr11930 lcl|tdcB-XFF4834R_chr11930

59

145

S=99 I=30 E=2.41826e-05

catabolic threonine dehydratase, PLP-dependent

pubmed

9

405

S=1482 I=69 E=8.72187e-171

Tryptophan synthase beta chain ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Pubmed 12754231

 

prodomImg

pubmed

8

405

S=1435 I=66 E=3.72514e-165

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Pubmed 2211532,2299982

 

prodomImg

pubmed

10

405

S=1434 I=67 E=5.81105e-165

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Pubmed 19077236

 

prodomImg

pubmed

7

402

S=1430 I=68 E=1.61167e-164

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Pubmed 18700039

 

prodomImg

pubmed

4

397

S=1382 I=65 E=1.06447e-158

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Pubmed 8423001

 

prodomImg

pubmed

13

397

S=1377 I=65 E=3.93649e-158

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Pubmed 3127651

 

prodomImg

pubmed

7

397

S=1365 I=63 E=1.12957e-156

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Pubmed 2503057

 

prodomImg

pubmed

7

405

S=1362 I=64 E=2.79711e-156

TrpB EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate Tryptophan

Pubmed 15547262

 

prodomImg

pubmed

13

405

S=1350 I=65 E=7.61721e-155

Tryptophan synthase beta subunit ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Pubmed 11092742

 

prodomImg

pubmed

7

405

S=1348 I=63 E=1.28525e-154

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Pubmed 10517032

 

prodomImg

sp_Pdown

sp|Q3BRL3|TRPB_XANC5

1

405

S=2133 I=100 E=0

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

sp_Pdown

sp|Q8PJ28|TRPB_XANAC

1

405

S=2130 I=100 E=0

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

sp_Pdown

sp|B2SVN7|TRPB_XANOP

1

405

S=2112 I=99 E=0

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

sp_Pdown

sp|Q2P0U2|TRPB_XANOM

1

405

S=2109 I=98 E=0

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

sp_Pdown

sp|Q8P7R8|TRPB_XANCP

1

405

S=2057 I=95 E=0

Tryptophan synthase beta chain EC=4.2.1.20 ; Amino-acid biosynthesis Aromatic Lyase Pyridoxal phosphate

Iprscan [G3DSA:3.40.50.1100]

184

398

-

Iprscan [PTHR10314:SF3]

26

400

-

Iprscan [PTHR10314]

26

400

-

Iprscan IPR001926 [PF00291]

64

388

Pyridoxal phosphate-dependent enzyme, beta subunit

Iprscan IPR006654 [TIGR00263]

17

401

Tryptophan synthase, beta chain

Iprscan IPR006653 [PS00168]

91

105

Tryptophan synthase, beta chain, conserved site

PDA1F6P8

315

388

S=238 I=60 E=2.59691e-21

PDA1V4U8

116

173

S=161 I=71 E=4.87088e-12

PD001443

272

314

S=161 I=70 E=5.13247e-12

PD414066

207

289

S=157 I=46 E=1.47399e-11

PDA1F6W1

77

114

S=152 I=79 E=6.37715e-11

PDA39434

117

205

S=149 I=38 E=1.23709e-10

PDA1F6Y5

176

205

S=135 I=83 E=7.25602e-09

PD001697

18

76

S=127 I=54 E=5.98457e-08

PDA85825

46

80

S=102 I=51 E=6.74459e-05