Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr29910XFF4834R_chr32470941_3438062_r2_XFF4834R-XFF4834R_chr29910XFF4834R_chr29910putative prephenate dehydrogenase

XFF4834R_chr32470941_3438062_r2_XFF4834R-XFF4834R_chr29910 XFF4834R_chr29910
XFF4834R_chr29900
XFF4834R_chr29900
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29920
XFF4834R_chr29920
ID XFF4834R_chr32470941_3438062_r2_XFF4834R-XFF4834R_chr29910
AC XFF4834R_chr29910
LT XFF4834R_chr29910
OR XFF4834R_chr from 3436941 to 3438062 on strand -
DE putative prephenate dehydrogenase
IP Amino acid-binding ACT; Prephenate dehydrogenase; NAD(P)-binding domain
CL 1.5.1.14 Tyrosine GO:0006571
EC
GO InterPro
Biological Process: tyrosine biosynthetic process (GO:0006571)
Biological Process: metabolic process (GO:0008152)
Molecular Function: prephenate dehydrogenase (NADP+) activity (GO:0004665)
Molecular Function: amino acid binding (GO:0016597)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 40750.3 Da
SQ 373 aa
 
........10........20........30........40........50
| | | | |
MIAQPVVGIVGIAGAYGRWLAQFLRTRMQLEVIGFDPADSGSMDEVTLAQ
RADVLMFAAPIRHTAALIERYVQLAGARAASQLWLDVTSIKQAPVAAMLT
SQADVVGLHPMTAPPKSPTLKGRVMVVCEARLQHWSAWVQSLCSALQAEC
VYATPEHHDRVMALVQAMVHATHLAQAGTLRDYAPLLGELRALMPYRSAS
FELDTAVIARILSLNPSIYEDIQFGNPYVGEMLDRLLLQLQQLRALVAQG
DDAARAQFRTQFLHDNAQALQHDALAAGNYTYERVGYLLADLTEPLTLSV
YLPEDQPGSLRALLHVFERHGVNLSSIHSSRTPVGELHFRIGFEAASDRA
ALTQAASEIDRTGIGRVLERSGG
XFF4834R

NP_641858.1 lcl|tyrA-XAC1525

16

372

S=1718 I=92 E=0

prephenate dehydrogenase

XFF4834R

YP_363298.1 lcl|XCV1567

16

372

S=1689 I=92 E=0

prephenate dehydrogenase

XFF4834R

NP_636849.1 lcl|tyrA-XCC1477

16

370

S=1467 I=82 E=1.18036e-170

prephenate dehydrogenase

XFF4834R

lcl|XALc_1675

16

368

S=1252 I=69 E=1.41148e-144

probable prephenate dehydrogenase protein

pubmed

47

222

S=150 I=29 E=2.04886e-09

T-protein EC=5.4.99.5 EC=1.3.1.12 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Multifunctional enzyme NAD Oxidoreductase Tyrosine

Pubmed 1512561

 

prodomImg

pubmed

85

222

S=149 I=31 E=2.33513e-09

T-protein EC=5.4.99.5 EC=1.3.1.12 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Multifunctional enzyme NAD Oxidoreductase Tyrosine

Pubmed 6396419

 

prodomImg

sp_Pdown

sp|Q58029|Y612_METJA

17

232

S=246 I=27 E=2.91326e-21

Probable arogenate/prephenate dehydrogenase EC=1.3.1.- ; NADP Oxidoreductase

sp_Pdown

sp|P43902|TYRA_HAEIN

52

222

S=160 I=30 E=8.15354e-11

T-protein EC=5.4.99.5 EC=1.3.1.12 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Multifunctional enzyme NAD Oxidoreductase Tyrosine

sp_Pdown

sp|Q02287|TYRA_ENTAG

47

222

S=150 I=29 E=1.41102e-09

T-protein EC=5.4.99.5 EC=1.3.1.12 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Multifunctional enzyme NAD Oxidoreductase Tyrosine

sp_Pdown

sp|P07023|TYRA_ECOLI

85

222

S=149 I=31 E=1.60817e-09

T-protein EC=5.4.99.5 EC=1.3.1.12 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Multifunctional enzyme NAD Oxidoreductase Tyrosine

Iprscan IPR003099 [PTHR21363]

25

259

Prephenate dehydrogenase

Iprscan IPR003099 [PF02153]

44

252

Prephenate dehydrogenase

Iprscan IPR002912 [PF01842]

297

352

Amino acid-binding ACT

Iprscan [seg]

2

15

-

Iprscan [seg]

233

249

-

PD298822

250

372

S=486 I=84 E=2.06437e-51

PD875904

52

131

S=125 I=37 E=1.27561e-07

PD655342

154

227

S=118 I=35 E=7.61992e-07

Iprscan [SSF55021]

280

361

-

Iprscan IPR016040 [SSF51735]

6

161

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eK3kO5w3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSbCBLC/XFF4834R_chr29910.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSbCBLC/XFF4834R_chr29910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSbCBLC/XFF4834R_chr29910.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSbCBLC/XFF4834R_chr29910.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.