Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr06090XFF4834R_chr06270914_0686693_r2_XFF4834R-XFF4834R_chr06090XFF4834R_chr06090putative carboxycyclohexadienyl dehydratase
  2. XFF4834R_chr28590pheAXFF4834R_chr28590P-protein

XFF4834R_chr06270914_0686693_r2_XFF4834R-XFF4834R_chr06090 XFF4834R_chr06090
XFF4834R_chr06080
XFF4834R_chr06080
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06100
XFF4834R_chr06100
ID XFF4834R_chr06270914_0686693_r2_XFF4834R-XFF4834R_chr06090
AC XFF4834R_chr06090
LT XFF4834R_chr06090
OR XFF4834R_chr from 685914 to 686693 on strand -
DE putative carboxycyclohexadienyl dehydratase
IP Extracellular solute-binding protein, family 3
CL 1.5.1.13 Phenylalanine GO:0009094
EC
GO InterPro
Biological Process: transport (GO:0006810)
Cellular Component: outer membrane-bounded periplasmic space (GO:0030288)
Molecular Function: transporter activity (GO:0005215)

Curated
PM
AN
CC COG: [ET] Amino acid transport and metabolism;Signal transduction mechanisms;
CC MODEL: acur
CC STATUS: curated by darrasse (20110304)
MW 28917.6 Da
SQ 259 aa
 
........10........20........30........40........50
| | | | |
MRYRICLALLLSCGTTHAATPASRLDAVLQSGVLRVCTTGDYRPYSLLRD
DGQFEGSDIDLVQSLAASLDARARLVRTSRPHLMPDLLADRCDIAVGGIS
VTLQRQRQASFSAVLDVDGKIPLVRCVDQARYRTLEQLNRPEVRLIEPPG
GTNEAFAHRQLPQAALRLFADNTTIFQELLAHRADVMITDASEALYQQAR
LPGLCAIAPEQPLQYSEKAFLLPRDDHAWKAYVDQWLHLTKASGEYQRIV
EGWHVSRAE
XFF4834R

NP_640951.2 lcl|pheC-XAC0598

1

259

S=1248 I=93 E=2.74191e-144

cyclohexadienyl dehydratase

XFF4834R

YP_362384.1 lcl|pheC-XCV0653

1

257

S=1209 I=90 E=1.5628e-139

putative carboxycyclohexadienyl dehydratase

pubmed

23

253

S=573 I=49 E=6.44075e-61

Cyclohexadienyl dehydratase EC=4.2.1.51 EC=4.2.1.91 ; Amino-acid biosynthesis Aromatic Lyase Multifunctional enzyme Periplasm Phenylalanine Signa

Pubmed 1733946

 

prodomImg

pubmed

23

132

S=266 I=48 E=1.04453e-23

Cyclohexadienyl dehydratase

Pubmed 17185531

 

prodomImg

pubmed

6

254

S=149 I=25 E=1.51513e-09

GlnH-like protein ; Plasmid

Pubmed 12511498

 

prodomImg

pubmed

6

253

S=148 I=22 E=2.12874e-09

Cystine-binding periplasmic protein ; Signal Transport

Pubmed 8550423

 

prodomImg

pubmed

6

254

S=145 I=22 E=5.22557e-09

Probable binding protein component of ABC transporter

Pubmed 16581904

 

prodomImg

pubmed

5

254

S=141 I=26 E=1.50072e-08

Lysine-arginine-ornithine-binding periplasmic protein ; Amino-acid transport Disulfide bond Signal

Pubmed 6273842

 

prodomImg

sp_Pdown

sp|Q01269|PHEC_PSEAE

23

253

S=573 I=49 E=4.44376e-61

Cyclohexadienyl dehydratase EC=4.2.1.51 EC=4.2.1.91 ; Amino-acid biosynthesis Aromatic Lyase Multifunctional enzyme Periplasm Phenylalanine Signa

sp_Pdown

sp|P0AEM9|FLIY_ECOLI

6

253

S=148 I=22 E=1.46871e-09

Cystine-binding periplasmic protein ; Signal Transport

sp_Pdown

sp|P0AEN0|FLIY_ECOL6

6

253

S=148 I=22 E=1.46871e-09

Cystine-binding periplasmic protein ; Signal Transport

sp_Pdown

sp|P02911|ARGT_SALTY

5

254

S=141 I=26 E=1.03542e-08

Lysine-arginine-ornithine-binding periplasmic protein ; Amino-acid transport Disulfide bond Signal

sp_Pdown

sp|P09551|ARGT_ECOLI

1

198

S=122 I=27 E=1.9365e-06

Lysine-arginine-ornithine-binding periplasmic protein ; Amino-acid transport Disulfide bond Phosphoprotein Signal

Iprscan [G3DSA:3.40.190.10]

29

125

-

Iprscan IPR001638 [PF00497]

34

253

Extracellular solute-binding protein, family 3

Iprscan IPR001638 [SM00062]

33

257

Extracellular solute-binding protein, family 3

Iprscan [seg]

64

75

-

Iprscan [SignalP-NN(euk)]

1

18

-

PD824861

111

253

S=490 I=64 E=6.72864e-52

PDA1K232

76

108

S=135 I=82 E=7.14469e-09

PDA1V3N4

201

253

S=109 I=34 E=1.14121e-05

Iprscan [SSF53850]

29

253

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nNgYQ7ce)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8ocOQG/XFF4834R_chr06090.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8ocOQG/XFF4834R_chr06090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8ocOQG/XFF4834R_chr06090.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8ocOQG/XFF4834R_chr06090.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pheA XFF4834R_chr28590
XFF4834R_chr28580
XFF4834R_chr28580
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28600
XFF4834R_chr28600
ID pheA
AC XFF4834R_chr28590
LT XFF4834R_chr28590
OR XFF4834R_chr from 3291521 to 3292729 on strand -
DE P-protein
IP Prephenate dehydratase; Chorismate mutase; Amino acid-binding ACT; Gamma/beta/epsilon proteobacterial P-protein, chorismate mutase domain;
CL 1.5.1.13 Phenylalanine GO:0009094
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: chorismate metabolic process (GO:0046417)
Biological Process: L-phenylalanine biosynthetic process (GO:0009094)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: chorismate mutase activity (GO:0004106)
Molecular Function: amino acid binding (GO:0016597)
Molecular Function: prephenate dehydratase activity (GO:0004664)

Curated
PM
AN genProtEC : fused chorismate mutase P - prephenate dehydratase Metabolism --> Building block biosynthesis --> Amino acids --> Phenylalanine Metabolism --> Building block biosynthesis --> Amino acids --> Tyrosine Location of gene products --> Cytoplasm
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 43721.4 Da
SQ 402 aa
 
........10........20........30........40........50
| | | | |
MAPKSNKPTAATGGNKKPTKTAANASGSKPANTPAEKAAIKTAAPVLADV
RAKIDEIDRNIQALIAERANFAHQVGKAKGKLAAAVDYYRPEREAQVLRM
VVDRNEGPLSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLK
HFGRSAVGLPMATIEEVFQEVEAGNADFGVVPVENSGQGTIQVTLDMFLT
SNLKICGEVELRVHQYLLSRNGRLEDIERIYAHSQSFAQTAGWLRSHLPK
VEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKKVIMKSIEDDDDN
TTRFLVIGRQIFPSSGHDRTSVLVFIHDKPGALFDVLSPFARHGISMNRI
ESRPSHQAKWEYGFFIDLIGHVEDDAMKQALAELKAHSAQIKVLGSYPVA
IP
pubmed

1

402

S=1768 I=85 E=0

P-protein

Pubmed 9689222

 

prodomImg

pubmed

47

401

S=876 I=47 E=2.13881e-97

P-protein EC=5.4.99.5 EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Lyase Multifunctional enzyme Phenylalanine

Pubmed 1919506,10368439

 

prodomImg

pubmed

51

401

S=758 I=44 E=3.99493e-83

Putative chorismate mutase/prephenate dehydratase PheA

Pubmed 10844690

 

prodomImg

pubmed

51

401

S=747 I=43 E=9.79842e-82

P-protein EC=5.4.99.5 EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Lyase Multifunctional enzyme Phenylalanine

Pubmed 10094619

 

prodomImg

pubmed

51

401

S=741 I=43 E=5.55483e-81

PheA

Pubmed 10844690

 

prodomImg

pubmed

134

397

S=394 I=33 E=5.27066e-39

Prephenate dehydratase EC=4.2.1.51 ; Lyase

Pubmed 12446909

 

prodomImg

pubmed

45

398

S=362 I=29 E=4.00897e-35

P-protein EC=5.4.99.5 EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Lyase Multifunctional enzyme Phenylalanine

Pubmed 6396419

 

prodomImg

pubmed

45

398

S=358 I=27 E=1.20263e-34

P-protein EC=5.4.99.5 EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Lyase Multifunctional enzyme Phenylalanine

Pubmed 1512561,1444388

 

prodomImg

pubmed

132

399

S=345 I=34 E=5.06458e-33

Prephenate dehydratase

Pubmed 18621904

 

prodomImg

pubmed

132

397

S=340 I=32 E=1.77746e-32

Prephenate dehydratase EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Lyase Phenylalanine

Pubmed 2537815

 

prodomImg

sp_Pdown

sp|P27603|PHEA_PSEST

47

401

S=876 I=47 E=1.47195e-97

P-protein EC=5.4.99.5 EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Lyase Multifunctional enzyme Phenylalanine

sp_Pdown

sp|Q9HZ67|PHEA_PSEAE

47

401

S=867 I=47 E=1.70569e-96

P-protein EC=5.4.99.5 EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Lyase Multifunctional enzyme Phenylalanine

sp_Pdown

sp|O67085|PHEA_AQUAE

47

401

S=751 I=41 E=1.93824e-82

P-protein EC=5.4.99.5 EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Lyase Multifunctional enzyme Phenylalanine

sp_Pdown

sp|Q9ZHY3|PHEA_NEIG1

51

401

S=747 I=43 E=6.74338e-82

P-protein EC=5.4.99.5 EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Lyase Multifunctional enzyme Phenylalanine

sp_Pdown

sp|P43900|PHEA_HAEIN

47

401

S=388 I=29 E=2.28317e-38

P-protein EC=5.4.99.5 EC=4.2.1.51 ; Amino-acid biosynthesis Aromatic Cytoplasm Isomerase Lyase Multifunctional enzyme Phenylalanine

Iprscan [coil]

47

68

-

Iprscan [G3DSA:1.20.59.10]

29

121

-

Iprscan IPR008242 [PIRSF001500]

45

402

Bifunctional P-protein, chorismate mutase/prephenate dehydratase

Iprscan [PTHR21022]

90

402

-

Iprscan IPR001086 [PF00800]

134

310

Prephenate dehydratase

Iprscan IPR020822 [PF01817]

51

131

Chorismate mutase, type II

Iprscan IPR002912 [PF01842]

320

384

Amino acid-binding ACT

Iprscan IPR002701 [SM00830]

51

132

Chorismate mutase

Iprscan IPR010957 [TIGR01807]

47

122

Gamma/beta/epsilon proteobacterial P-protein, chorismate mutase domain

Iprscan [seg]

76

85

-

Iprscan [seg]

259

277

-

PD878413

196

398

S=203 I=29 E=3.73055e-17

PD622031

1

46

S=188 I=89 E=2.94315e-15

PD534038

132

198

S=184 I=51 E=7.35182e-15

PD973154

306

397

S=168 I=38 E=6.05852e-13

PD696822

89

130

S=154 I=67 E=3.28538e-11

PD929918

313

375

S=139 I=40 E=2.56944e-09

PDA090E3

227

398

S=134 I=25 E=9.17631e-09

PDA1D637

360

398

S=127 I=54 E=6.58292e-08

PDA76919

305

355

S=121 I=43 E=3.27443e-07

PDA1D1T0

319

397

S=119 I=35 E=6.24218e-07

Iprscan [SSF55021]

304

401

-

Iprscan IPR020822 [SSF48600]

45

136

Chorismate mutase, type II

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one FOgWc8HJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

27 hits
swiss-prot

Swiss-Prot ncbi-blastp

27 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8ocOQG/XFF4834R_chr28590.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8ocOQG/XFF4834R_chr28590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8ocOQG/XFF4834R_chr28590.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8ocOQG/XFF4834R_chr28590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.