Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr13080cysKXFF4834R_chr13080cysteine synthase
  2. XFF4834R_chr15680cysQXFF4834R_chr15680probable PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase
  3. XFF4834R_chr34970XFF4834R_chr38160942_4061312_r2_XFF4834R-XFF4834R_chr34970XFF4834R_chr34970putative cystathionine beta-synthase

cysK XFF4834R_chr13080
XFF4834R_chr13070
XFF4834R_chr13070
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13090
XFF4834R_chr13090
ID cysK
AC XFF4834R_chr13080
LT XFF4834R_chr13080
OR XFF4834R_chr from 1489618 to 1490577 on strand -
DE cysteine synthase
IP Pyridoxal phosphate-dependent enzyme, beta subunit
CL 1.5.1.12 Cysteine GO:0019344
EC
GO InterPro
Biological Process: cysteine biosynthetic process from serine (GO:0006535)
Biological Process: metabolic process (GO:0008152)
Molecular Function: cysteine synthase activity (GO:0004124)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: pyridoxal phosphate binding (GO:0030170)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120330)
MW 34099.6 Da
SQ 319 aa
 
........10........20........30........40........50
| | | | |
MALYDNILDTIGRTPVVKLQRLAPDNVTLYVKVESFNPGGSVKDRLALAI
ILDAEQRGLLKPGDTIVEATSGNTGVALAMVAAARGYKFVATMVETFSIE
RRKLMRAYGAKVILTPAAERGSGMVRKAKELAEQHGWFLASQFANPANPA
YHRNTTAAEILRDFAGHRLDHFVTGWGTGGTLTGVGEVLSVARPEVRITA
TEPAGAALLQGQDWKPHKIQGWTPDFVPEVLNREVAHEVLSLEDTDAITV
ARRLAAEEGIFTGISGGATVATALRVAEGAVPGAVILAMLPDTGERYFST
PLFADINEGSDDDWLAGLP
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr34970 lcl|XFF4834R_chr38160942_4061312_r2_XFF4834R-XFF4834R_chr34970

1

299

S=435 I=34 E=3.35999e-46

XFF4834R

XFF4834R_chr35240 lcl|XFF4834R_chr38460231_4094334_r1_XFF4834R-XFF4834R_chr35240

27

165

S=150 I=31 E=1.11662e-11

XFF4834R

NP_643648.1 lcl|cysK-XAC3341

1

319

S=1539 I=93 E=1.80291e-179

cysteine synthase

XFF4834R

YP_365190.1 lcl|cysK-XCV3459

1

319

S=1522 I=92 E=2.44217e-177

cysteine synthase

XFF4834R

NP_638528.1 lcl|cysK-XCC3182

1

319

S=1510 I=91 E=5.98996e-176

cysteine synthase

XFF4834R

lcl|cysK-XALc_2522

1

319

S=1381 I=83 E=2.96816e-160

probable cysteine synthase protein

XFF4834R

lcl|XALc_2713

1

299

S=440 I=35 E=3.07567e-46

probable cystathionine beta-synthase protein

XFF4834R

NP_635989.1 lcl|cysB-XCC0597

1

299

S=437 I=35 E=6.23227e-46

cystathionine beta-synthase

XFF4834R

NP_643910.1 lcl|cysB-XAC3603

1

299

S=430 I=34 E=4.35549e-45

cystathionine beta-synthase

XFF4834R

YP_365457.1 lcl|XCV3726

1

299

S=428 I=34 E=7.67644e-45

cystathionine beta-synthase

XFF4834R

lcl|cysK-XALc_2730

14

164

S=156 I=33 E=7.27499e-12

probable cysteine synthase protein

XFF4834R

YP_365476.1 lcl|XCV3745

27

165

S=151 I=32 E=3.37487e-11

putative cysteine synthase

pubmed

3

316

S=818 I=54 E=1.82671e-90

Cysteine synthetase

Pubmed 18385218

 

prodomImg

pubmed

2

313

S=806 I=51 E=4.76236e-89

Chloroplast O-acetyl-serine lyase

Pubmed 16490209

 

prodomImg

pubmed

3

315

S=797 I=53 E=6.45635e-88

Chloroplast O-acetyl-serine lyase

Pubmed 16490209

 

prodomImg

pubmed

4

306

S=767 I=52 E=2.64431e-84

Chloroplast O-acetyl-serine lyase/glutaredoxin fusion protein

Pubmed 16490209

 

prodomImg

pubmed

5

303

S=710 I=48 E=1.95449e-77

Cysteine synthase EC=2.5.1.47 ; Amino-acid biosynthesis Pyridoxal phosphate Transferase

Pubmed 7584024

 

prodomImg

pubmed

1

303

S=705 I=45 E=8.8328e-77

Cysteine synthase EC=2.5.1.47 ; Amino-acid biosynthesis Lyase Transferase

Pubmed 10568807

 

prodomImg

pubmed

1

306

S=671 I=46 E=1.08523e-72

Probable cysteine synthase EC=2.5.1.47 ; Amino-acid biosynthesis Pyridoxal phosphate Transferase

Pubmed 9387221

 

prodomImg

pubmed

5

303

S=658 I=47 E=4.49119e-71

Cysteine synthase EC=2.5.1.47 ; Amino-acid biosynthesis Transferase

Pubmed 11685509

 

prodomImg

pubmed

5

303

S=653 I=48 E=1.89293e-70

Cysteine synthase EC=2.5.1.47 ; Amino-acid biosynthesis Transferase

Pubmed 16233442

 

prodomImg

pubmed

3

305

S=647 I=43 E=8.26141e-70

Cysteine synthase EC=2.5.1.47 ; Amino-acid biosynthesis Transferase

Pubmed 10085076

 

prodomImg

Iprscan [G3DSA:3.40.50.1100]

116

299

-

Iprscan IPR001926 [PF00291]

7

292

Pyridoxal phosphate-dependent enzyme, beta subunit

Iprscan IPR005856 [TIGR01136]

7

303

Cysteine synthase K/M

Iprscan IPR005859 [TIGR01139]

7

303

Cysteine synthase A

Iprscan IPR001216 [PS00901]

32

50

Cysteine synthase/cystathionine beta-synthase P-phosphate-binding site

Iprscan [seg]

173

191

-

PDA1F6I9

1

63

S=192 I=56 E=9.97604e-16

PDA346N7

99

131

S=158 I=97 E=1.2692e-11

PDA01522

14

267

S=143 I=26 E=7.06494e-10

PDA3X4S0

28

98

S=120 I=38 E=5.28525e-07

PD925716

64

98

S=119 I=69 E=5.97141e-07

PDA7L7M5

99

127

S=110 I=72 E=8.38278e-06

PD925714

65

116

S=105 I=46 E=2.84118e-05

PD483887

4

160

S=105 I=27 E=2.86606e-05

PDA2B575

66

117

S=102 I=40 E=7.60981e-05

PD639555

194

247

S=101 I=42 E=8.30307e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one u0WUOuky)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

122 hits
swiss-prot

Swiss-Prot ncbi-blastp

70 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr13080.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr13080.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr13080.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr13080.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
cysQ XFF4834R_chr15680
XFF4834R_chr15670
XFF4834R_chr15670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15690
XFF4834R_chr15690
ID cysQ
AC XFF4834R_chr15680
LT XFF4834R_chr15680
OR XFF4834R_chr from 1816019 to 1816819 on strand +
DE probable PAPS (adenosine 3'-phosphate 5'-phosphosulfate) 3'(2'),5'-bisphosphate nucleotidase
IP Inositol monophosphatase
CL 1.5.1.12 Cysteine GO:0019344
EC
GO InterPro
Cellular Component: membrane (GO:0016020)
Molecular Function: inositol or phosphatidylinositol phosphatase activity (GO:0004437)
Molecular Function: magnesium ion binding (GO:0000287)

Curated
PM
AN description of this gene in other Xanthomonas genomes is apparently inconsistent with this one, despite high homology
CC COG: [P] Inorganic ion transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by lgagnevin (20100717)
MW 29339.9 Da
SQ 266 aa
 
........10........20........30........40........50
| | | | |
MIRIPMELRETVIAIARDAGAAIMEVYAQDFSVEIKDDASPLTQADLAAN
RVIVDGLRRVTPDVPVLSEESAHVAWEQRQYWTSYWLVDPLDGTREFVKR
NGEFSVNIALIHMGAPVLGVVQAPVDGRVWYAARGENAFRRDGDRDEMLH
TRTPAATPLRVAASRSHRDARTAAALERMGEIDVVAQGSSLKFCRIAEGD
LDVYPRFGPTSEWDTAAGQCVLHAAGGVLLAGASGKPFRYNRRDTLLNGD
FIALGDPNLPWRDWLA
XFF4834R

XFF4834R_chr23960 lcl|suhB-XFF4834R_chr23960

43

218

S=152 I=30 E=5.58848e-12

inositol monophosphatase

XFF4834R

YP_364931.1 lcl|cysQ-XCV3200

1

266

S=1301 I=94 E=1.15483e-150

sulfite synthesis pathway protein

XFF4834R

NP_643375.2 lcl|cysQ-XAC3066

1

266

S=1293 I=94 E=1.02128e-149

sulfite synthesis pathway protein

XFF4834R

NP_638230.2 lcl|cysQ-XCC2882

1

265

S=1245 I=90 E=6.74534e-144

sulfite synthesis pathway protein

XFF4834R

lcl|cysQ-XALc_2210

1

264

S=956 I=72 E=7.53173e-109

putative sulfite synthesis pathway protein

XFF4834R

lcl|suhB-XALc_1925

31

218

S=155 I=31 E=7.71175e-12

probable inositol monophosphatase protein

XFF4834R

YP_364313.1 lcl|suhB-XCV2582

43

218

S=152 I=30 E=2.0836e-11

myo-inositol-1(or 4)-monophosphatase

XFF4834R

NP_642701.1 lcl|suhB-XAC2385

43

218

S=152 I=30 E=2.0836e-11

extragenic supressor protein SuhB

XFF4834R

NP_637632.1 lcl|suhB-XCC2277

43

218

S=152 I=30 E=2.12025e-11

extragenic supressor protein

pubmed

8

215

S=536 I=54 E=2.15856e-56

3'(2'),5'-bisphosphate nucleotidase cysQ EC=3.1.3.7 ; Cell inner membrane Cytoplasm Hydrolase Magnesium Metal-binding

Pubmed 2172762

 

prodomImg

pubmed

8

251

S=531 I=49 E=8.86293e-56

3'(2'),5'-bisphosphate nucleotidase cysQ EC=3.1.3.7 ; Cell inner membrane Cytoplasm Hydrolase Magnesium Metal-binding

Pubmed 1856684,1729235

 

prodomImg

pubmed

4

261

S=446 I=35 E=1.63227e-45

3'(2'),5'-bisphosphate nucleotidase cysQ EC=3.1.3.7 ; Cell inner membrane Cytoplasm Hydrolase Magnesium Metal-binding

Pubmed 9020051

 

prodomImg

pubmed

7

265

S=442 I=40 E=5.93192e-45

3'(2'),5'-bisphosphate nucleotidase EC=3.1.3.25 EC=3.1.3.7 CysQ ; Hydrolase

Pubmed 12438347

 

prodomImg

pubmed

15

253

S=439 I=40 E=1.35804e-44

3-phosphoadenosine-5-phosphosulfate PAPS-3 phosphatase

Pubmed 18028413

 

prodomImg

sp_Pdown

sp|P26264|CYSQ_SALTY

8

215

S=536 I=54 E=1.48654e-56

3'(2'),5'-bisphosphate nucleotidase cysQ EC=3.1.3.7 ; Cell inner membrane Cytoplasm Hydrolase Magnesium Metal-binding

sp_Pdown

sp|Q8XCG6|CYSQ_ECO57

8

251

S=534 I=49 E=2.96012e-56

3'(2'),5'-bisphosphate nucleotidase cysQ EC=3.1.3.7 ; Cell inner membrane Cytoplasm Hydrolase Magnesium Metal-binding

sp_Pdown

sp|P22255|CYSQ_ECOLI

8

251

S=531 I=49 E=6.10364e-56

3'(2'),5'-bisphosphate nucleotidase cysQ EC=3.1.3.7 ; Cell inner membrane Cytoplasm Hydrolase Magnesium Metal-binding

sp_Pdown

sp|Q8FAG5|CYSQ_ECOL6

8

251

S=530 I=49 E=8.20976e-56

3'(2'),5'-bisphosphate nucleotidase cysQ EC=3.1.3.7 ; Cell inner membrane Cytoplasm Hydrolase Magnesium Metal-binding

sp_Pdown

sp|P59735|CYSQ_SHIFL

8

251

S=528 I=48 E=1.55148e-55

3'(2'),5'-bisphosphate nucleotidase cysQ EC=3.1.3.7 ; Cell inner membrane Cytoplasm Hydrolase Magnesium Metal-binding

Iprscan IPR000760 [PR00377]

40

60

Inositol monophosphatase

Iprscan IPR000760 [PR00377]

62

78

Inositol monophosphatase

Iprscan IPR000760 [PR00377]

86

102

Inositol monophosphatase

Iprscan [G3DSA:3.30.540.10]

7

152

-

Iprscan [PTHR20854:SF5]

62

259

-

Iprscan IPR000760 [PTHR20854]

62

259

Inositol monophosphatase

Iprscan IPR000760 [PF00459]

8

247

Inositol monophosphatase

Iprscan IPR006240 [TIGR01331]

8

255

3(2),5 -bisphosphate nucleotidase, bacterial

Iprscan IPR020583 [PS00629]

86

99

Inositol monophosphatase, metal-binding site

Iprscan IPR020550 [PS00630]

213

227

Inositol monophosphatase, conserved site

Iprscan [seg]

222

235

-

PDA1K766

236

266

S=176 I=100 E=7.92103e-14

PD918500

165

214

S=165 I=62 E=1.58979e-12

PDA1S783

137

187

S=152 I=61 E=6.52215e-11

PD589315

85

139

S=144 I=49 E=5.76789e-10

PDA241X0

137

165

S=142 I=97 E=1.04352e-09

PDA323Q4

1

28

S=126 I=96 E=9.63153e-08

PD023420

7

73

S=124 I=40 E=1.65371e-07

PDA2J6B0

137

160

S=115 I=88 E=2.22248e-06

PDA7T958

42

82

S=106 I=41 E=2.48713e-05

Iprscan [SSF56655]

5

265

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uA9EpWSW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

58 hits
swiss-prot

Swiss-Prot ncbi-blastp

57 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr15680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr15680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr15680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr15680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr38160942_4061312_r2_XFF4834R-XFF4834R_chr34970 XFF4834R_chr34970
XFF4834R_chr34970
XFF4834R_chr34970
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3715
XFF4834R_chr_3715
ID XFF4834R_chr38160942_4061312_r2_XFF4834R-XFF4834R_chr34970
AC XFF4834R_chr34970
LT XFF4834R_chr34970
OR XFF4834R_chr from 4059942 to 4061312 on strand -
DE putative cystathionine beta-synthase
IP Cystathionine beta-synthase
CL 1.5.1.12 Cysteine GO:0019344
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: cysteine biosynthetic process from serine (GO:0006535)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN gene is named uptG in Xcc
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120410)
MW 49716.3 Da
SQ 456 aa
 
........10........20........30........40........50
| | | | |
MAIHSSVLELIGNTPIVKAQRLDTGVCELFLKLEANNPGGSIKDRIGLSM
IEAAERRGDLKPGATLVEGTAGNTGLGLALVAQQKGYQLILVVPDKMSRE
KIFNLKAMGANVVLTRSDVAKGHPEYYQDLAARIAAETPGAYFINQFGNP
DNPAAHEFGTGPEILAQMDGRLDAIVFGCGSSGTMTGLSRAFASASPHTE
LVLADPVGSILTQYIEEGTVSEKSGSWLVEGIGEDFLPDISDFSRVKKAY
SISDAESFHTARELLAKEGILGGSSTGTLLAAALKYCREQTTPKRVLVFV
CDTGNKYLSKMYNDYWMLDNGFLERPQHGDLRDLILRPYNKRDTVVVGPK
DLLTTAYQRMKLYDVSQLPVIDDGELVGIVDESDVLLHVYGDEARFRDPI
STAMVSKLDRLDVASPIEALLPVFDRGQVAIVMDGTQFLGLITRIDLLNY
LRRRVQ
XFF4834R

XFF4834R_chr13080 cysK-XFF4834R_chr13080

1

309

S=358 I=32 E=1.0986e-36

cysteine synthase

XFF4834R

XFF4834R_chr35240 XFF4834R_chr38460231_4094334_r1_XFF4834R-XFF4834R_chr35240

28

316

S=125 I=23 E=1.77951e-08

Putative cysteine synthase

XFF4834R

NP_643910.1 cysB-XAC3603

1

456

S=2247 I=94 E=0

cystathionine beta-synthase

XFF4834R

YP_365457.1 XCV3726

1

456

S=2233 I=93 E=0

cystathionine beta-synthase

XFF4834R

NP_635989.1 cysB-XCC0597

1

456

S=2204 I=92 E=0

cystathionine beta-synthase

XFF4834R

XALc_2713 XALc_2713

1

456

S=2057 I=85 E=0

probable cystathionine beta-synthase protein

XFF4834R

YP_365190.1 cysK-XCV3459

1

309

S=363 I=32 E=1.08994e-36

cysteine synthase

XFF4834R

NP_643648.1 cysK-XAC3341

1

309

S=362 I=32 E=1.4407e-36

cysteine synthase

XFF4834R

XALc_2522 cysK-XALc_2522

1

309

S=357 I=32 E=5.42152e-36

probable cysteine synthase protein

XFF4834R

NP_638528.1 cysK-XCC3182

1

309

S=352 I=32 E=2.32524e-35

cysteine synthase

XFF4834R

XALc_2730 cysK-XALc_2730

28

321

S=149 I=24 E=7.39506e-11

probable cysteine synthase protein

XFF4834R

YP_365476.1 XCV3745

28

316

S=123 I=23 E=1.08258e-07

putative cysteine synthase

XFF4834R

NP_643935.1 cysM-XAC3628

28

316

S=121 I=23 E=1.89146e-07

cysteine synthase

XFF4834R

NP_635971.1 cysM-XCC0578

28

318

S=118 I=22 E=5.43204e-07

cysteine synthase

pubmed

1

456

S=2203 I=92 E=0

Cystathionine beta-lyase EC=4.4.1.8

Pubmed 11589581

 

prodomImg

pubmed

1

455

S=1232 I=53 E=2.23287e-140

Cysteine synthase EC=2.5.1.47 ; Amino-acid biosynthesis Transferase

Pubmed 16885444

 

prodomImg

pubmed

1

451

S=651 I=36 E=6.26311e-70

Cystathionine beta-synthase

Pubmed 12101301

 

prodomImg

pubmed

102

322

S=609 I=56 E=6.92492e-65

Putative uncharacterized protein ; Pyridoxal phosphate

Pubmed 8469144,7808389

 

prodomImg

pubmed

1

451

S=588 I=35 E=2.34315e-62

Probable cystathionine beta-synthase

Pubmed 12375103

 

prodomImg

sp_Pdown

sp|Q91WT9|CBS_MOUSE

7

433

S=593 I=35 E=3.5364e-63

Cystathionine beta-synthase EC=4.2.1.22 ; Alternative splicing Amino-acid biosynthesis CBS domain Cysteine Cytoplasm Heme Iron Isopeptide bond

sp_Pdown

sp|Q9N0V7|CBS_RABIT

3

456

S=582 I=33 E=9.54685e-62

Cystathionine beta-synthase EC=4.2.1.22 ; Amino-acid biosynthesis CBS domain Cysteine Cytoplasm Heme Iron Isopeptide bond Lyase Metal-binding Nucleus Phosphoprote

sp_Pdown

sp|P32232|CBS_RAT

7

433

S=577 I=34 E=3.68781e-61

Cystathionine beta-synthase EC=4.2.1.22 ; Alternative splicing Amino-acid biosynthesis CBS domain Cysteine Cytoplasm Heme Iron Isopeptide bond Lyase

sp_Pdown

sp|P46794|CBS_DICDI

3

456

S=576 I=32 E=4.74873e-61

Cystathionine beta-synthase EC=4.2.1.22 ; Amino-acid biosynthesis CBS domain Cysteine Lyase Pyridoxal phosphate Repeat

sp_Pdown

sp|P35520|CBS_HUMAN

7

451

S=571 I=33 E=1.85043e-60

Cystathionine beta-synthase EC=4.2.1.22 ; Allosteric enzyme Alternative splicing Amino-acid biosynthesis CBS domain Cysteine Cytoplasm Disease mu

Iprscan [G3DSA:3.40.50.1100]

120

311

-

Iprscan [PTHR10314:SF8]

27

324

-

Iprscan [PTHR10314]

27

324

-

Iprscan IPR001926 [PF00291]

9

302

Pyridoxal phosphate-dependent enzyme, beta subunit

Iprscan IPR000644 [PF00571]

343

389

Cystathionine beta-synthase, core

Iprscan IPR000644 [SM00116]

343

390

Cystathionine beta-synthase, core

Iprscan IPR001216 [PS00901]

32

50

Cysteine synthase/cystathionine beta-synthase P-phosphate-binding site

Iprscan IPR000644 [PS51371]

339

396

Cystathionine beta-synthase, core

Iprscan [seg]

69

80

-

Iprscan [seg]

271

284

-

PDA0P8O3

190

260

S=275 I=75 E=7.74251e-26

PD476350

396

455

S=260 I=83 E=5.22112e-24

PDA1F6I9

1

64

S=183 I=54 E=1.13576e-14

PDA099J9

342

395

S=178 I=63 E=5.13275e-14

PDA1H9Y1

99

129

S=150 I=90 E=1.18241e-10

PDA1K436

315

341

S=139 I=81 E=2.41489e-09

PD002454

130

176

S=127 I=55 E=6.63391e-08

PDA2A738

310

341

S=114 I=63 E=2.51618e-06

PDA7L7K5

97

131

S=113 I=60 E=3.85728e-06

PD599081

309

398

S=106 I=29 E=2.91575e-05

Iprscan IPR001926 [SSF53686]

2

323

Pyridoxal phosphate-dependent enzyme, beta subunit

Iprscan [SSF54631]

330

392

-

Iprscan [SSF54631]

394

451

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RysEA8cg)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

132 hits
swiss-prot

Swiss-Prot ncbi-blastp

89 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr34970.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr34970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr34970.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBv8dAq6/XFF4834R_chr34970.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.