Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr19890serAXFF4834R_chr19890probable D-3-phosphoglycerate dehydrogenase
  2. XFF4834R_chr28600serCXFF4834R_chr28600Phosphoserine aminotransferase

serA XFF4834R_chr19890
XFF4834R_chr19880
XFF4834R_chr19880
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19900
XFF4834R_chr19900
ID serA
AC XFF4834R_chr19890
LT XFF4834R_chr19890
OR XFF4834R_chr from 2282700 to 2283941 on strand -
DE probable D-3-phosphoglycerate dehydrogenase
IP Amino acid-binding ACT; D-isomer specific 2-hydroxyacid dehydrogenase, catalytic region; D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding
CL 1.5.1.11 Serine GO:0006564
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cofactor binding (GO:0048037)
Molecular Function: NAD or NADH binding (GO:0051287)
Molecular Function: amino acid binding (GO:0016597)
Molecular Function: binding (GO:0005488)
NAD or NADP as acceptor (GO:0016616)

Curated
PM
AN
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 43897.7 Da
SQ 413 aa
 
........10........20........30........40........50
| | | | |
MSPKKTSFPKQDIRVLLLEGISPTAVDVFRAAGYSQIELHAKSLPEDELI
ARIADAHIVGIRSRTQLSADVLAHAKRLIAVGCFCIGTNQVDLDAAELAG
IPVFNAPYSNTRSVAELVIAEAILLLRGIPQKNAQCHRGGWSKSAAGSHE
TRGKVLGIVGYGHIGTQVGVLAESLGMQVIFHDIETKLSLGNARAAIDLD
DLLARADVVTLHVPETPSTKDMIGAPEIARMKPGAHLINASRGTVIDIDA
LDAALTSGQIGGAAVDVFPIEPKGNGDAFESPLTAHDNVILTPHVGGSTL
EAQDNIGIEVAAKLVRYSDNGSTLSAVNFPEVTLPEHAESLRLLHIHRNV
PGVLSQINELFSRHNVNIDGQFLRTDPKVGYVVIDVGASEELAGVLKDEL
GQITGTLRTRVLY
XFF4834R

XFF4834R_chr27210 lcl|ghrB-XFF4834R_chr27210

48

300

S=226 I=30 E=9.60965e-21

2-keto-D-gluconate reductase (glyoxalate reductase) (2-ketoaldonate reductase)

XFF4834R

XFF4834R_chr00230 lcl|XFF4834R_chr00180592_0024584_f3_XFF4834R-XFF4834R_chr00230

153

296

S=172 I=35 E=3.47484e-14

XFF4834R

XFF4834R_chr27210 lcl|ghrB-XFF4834R_chr27210

48

300

S=226 I=30 E=9.60965e-21

2-keto-D-gluconate reductase (glyoxalate reductase) (2-ketoaldonate reductase)

XFF4834R

XFF4834R_chr00230 lcl|XFF4834R_chr00180592_0024584_f3_XFF4834R-XFF4834R_chr00230

153

296

S=172 I=35 E=3.47484e-14

pubmed

5

413

S=1234 I=57 E=9.86081e-141

D-3-phosphoglycerate dehydrogenase EC=1.1.1.95 ; Amino-acid biosynthesis NAD Oxidoreductase Serine

Pubmed 3017965

 

prodomImg

pubmed

4

413

S=1084 I=52 E=1.4891e-122

Putative D-3-phosphoglycerate dehydrogenase ; Plasmid

Pubmed 17466030

 

prodomImg

pubmed

14

386

S=1004 I=53 E=6.56374e-113

D-3-phosphoglycerate dehydrogenase homolog ; Oxidoreductase

Pubmed 9583950

 

prodomImg

pubmed

1

413

S=956 I=45 E=4.77157e-107

D-3-phosphoglycerate dehydrogenase EC=1.1.1.95 ; Amino-acid biosynthesis NAD Oxidoreductase Serine

Pubmed 16926386

 

prodomImg

pubmed

16

412

S=913 I=45 E=6.853e-102

D-3-phosphoglycerate dehydrogenase-like protein EC=1.1.1.95 ; Oxidoreductase

Pubmed 12853638

 

prodomImg

pubmed

14

336

S=446 I=35 E=2.8049e-45

3-phosphoglycerate dehydrogenase ; Oxidoreductase

Pubmed 16978364

 

prodomImg

pubmed

14

384

S=437 I=31 E=3.73688e-44

3-phosphoglycerate dehydrogenase

Pubmed 17884813

 

prodomImg

pubmed

2

338

S=419 I=34 E=5.62017e-42

Putative D-3-phosphoglycerate dehydrogenase ; Oxidoreductase

Pubmed 14617179

 

prodomImg

pubmed

14

333

S=414 I=34 E=2.36877e-41

D-3-phosphoglycerate dehydrogenase EC=1.1.1.95 ; Acetylation Amino-acid biosynthesis Disease mutation NAD Oxidoreductase Phosphoprotein Serine

Pubmed 10713460,11055895

 

prodomImg

pubmed

14

333

S=413 I=34 E=2.92011e-41

D-3-phosphoglycerate dehydrogenase EC=1.1.1.95 ; Acetylation Amino-acid biosynthesis NAD Oxidoreductase Phosphoprotein Serine

Pubmed 17574350

 

prodomImg

sp_Pdown

sp|P0A9T3|SERA_SHIFL

5

413

S=1234 I=57 E=6.78476e-141

D-3-phosphoglycerate dehydrogenase EC=1.1.1.95 ; Amino-acid biosynthesis NAD Oxidoreductase Serine

sp_Pdown

sp|P0A9T0|SERA_ECOLI

5

413

S=1234 I=57 E=6.78476e-141

D-3-phosphoglycerate dehydrogenase EC=1.1.1.95 ; Amino-acid biosynthesis NAD Oxidoreductase Serine

sp_Pdown

sp|P0A9T1|SERA_ECOL6

5

413

S=1234 I=57 E=6.78476e-141

D-3-phosphoglycerate dehydrogenase EC=1.1.1.95 ; Amino-acid biosynthesis NAD Oxidoreductase Serine

sp_Pdown

sp|P0A9T2|SERA_ECO57

5

413

S=1234 I=57 E=6.78476e-141

D-3-phosphoglycerate dehydrogenase EC=1.1.1.95 ; Amino-acid biosynthesis NAD Oxidoreductase Serine

sp_Pdown

sp|P43885|SERA_HAEIN

5

413

S=1229 I=56 E=3.01319e-140

D-3-phosphoglycerate dehydrogenase EC=1.1.1.95 ; Amino-acid biosynthesis NAD Oxidoreductase Serine

Iprscan IPR016040 [G3DSA:3.40.50.720]

111

299

NAD(P)-binding domain

Iprscan [G3DSA:3.30.70.260]

330

413

-

Iprscan [PTHR10996:SF18]

7

374

-

Iprscan [PTHR10996]

7

374

-

Iprscan IPR006140 [PF02826]

120

296

D-isomer specific 2-hydroxyacid dehydrogenase, NAD-binding

Iprscan IPR006139 [PF00389]

15

328

D-isomer specific 2-hydroxyacid dehydrogenase, catalytic domain

Iprscan IPR002912 [PF01842]

347

397

Amino acid-binding ACT

Iprscan [seg]

114

126

-

Iprscan [seg]

193

207

-

PD010940

342

413

S=216 I=60 E=1.23248e-18

PD850676

280

364

S=142 I=35 E=1.03651e-09

PD685295

5

46

S=127 I=57 E=6.6915e-08

PDA1H2O0

312

337

S=123 I=88 E=1.97265e-07

PDA6F6E2

313

337

S=114 I=84 E=2.22689e-06

PDA289F3

318

341

S=112 I=92 E=4.55189e-06

PDA1K344

312

335

S=110 I=83 E=8.52747e-06

PDA1O8P7

312

335

S=105 I=83 E=3.41094e-05

PD000699

287

317

S=103 I=65 E=5.18354e-05

PDA6F6B5

317

339

S=102 I=83 E=6.17102e-05

Iprscan IPR016040 [SSF51735]

110

297

NAD(P)-binding domain

Iprscan [SSF52283]

9

141

-

Iprscan [SSF55021]

330

413

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3FI6JDvw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

159 hits
swiss-prot

Swiss-Prot ncbi-blastp

255 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG0PbUp/XFF4834R_chr19890.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG0PbUp/XFF4834R_chr19890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG0PbUp/XFF4834R_chr19890.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG0PbUp/XFF4834R_chr19890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
serC XFF4834R_chr28600
XFF4834R_chr28590
XFF4834R_chr28590
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3017
XFF4834R_chr_3017
ID serC
AC XFF4834R_chr28600
LT XFF4834R_chr28600
OR XFF4834R_chr from 3292814 to 3293899 on strand -
DE Phosphoserine aminotransferase
IP Aminotransferase, class V/Cysteine desulfurase; Phosphoserine aminotransferase; Pyridoxal phosphate-dependent transferase, major region, subdomain 1
CL 1.5.1.11 Serine GO:0006564
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: L-serine biosynthetic process (GO:0006564)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN GenProtEC : 3-phosphoserine/phosphohy droxythreonine aminotransferase Metabolism --> Building block biosynthesis --> Amino acids --> Serine Metabolism --> Building block biosynthesis --> Cofactor, small molecule carrier --> Pyridoxine (vitamin B6) Location of gene products --> Cytoplasm
CC COG: [EH] Amino acid transport and metabolism;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 38744.6 Da
SQ 361 aa
 
........10........20........30........40........50
| | | | |
MTRAFNFSAGPATLPESVLRQAQAEMVEWNGIGASIVEISHRSADFMAVA
AAAEADLRSLLSIPDDYAVLFTAGGATTIQALLPLNFAAPGQAADYVITG
HWGKTAIKQAATYVDARIAADAQAEGFVDIPPAASWTLSPHSAYVHITAN
ETIHGVEFRDTPDVGTLPLFADFSSSIASEPLDISRYGLIYAGAQKNLGP
VGISVVIVRRDLLERAGQPRADIFNYASHVARDSMLNTPPTWNWYLLGLT
VKWMLEQGGVQEFARRNAEKAALVYSAIDGSGGFYRNLIKPAVRSRMNIP
FFLPDEQLDALFVSESKAAGLLALKGHKAVGGIRASLYNAMPVAGAQALA
AFMHDFQQRHG
pubmed

5

361

S=882 I=48 E=3.65551e-98

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Pyridoxal phosphate

Pubmed 12517848

 

prodomImg

pubmed

1

361

S=870 I=47 E=1.1445e-96

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Cytoplasm Pyridoxal phosphate Pyridoxine

Pubmed 2691337

 

prodomImg

pubmed

3

360

S=867 I=44 E=2.5304e-96

Phosphoserine aminotransferase, chloroplastic EC=2.6.1.52 ; Amino-acid biosynthesis Plastid Pyridoxal phosphate Transit peptide

Pubmed 9881164

 

prodomImg

pubmed

5

361

S=865 I=47 E=4.26953e-96

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Pyridoxal phosphate

Pubmed 12517848

 

prodomImg

pubmed

5

361

S=863 I=47 E=7.26702e-96

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Pyridoxal phosphate

Pubmed 12517848

 

prodomImg

pubmed

5

361

S=858 I=46 E=3.03629e-95

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Cytoplasm Pyridoxal phosphate Pyridoxine

Pubmed 9350862

 

prodomImg

pubmed

5

361

S=854 I=46 E=9.68163e-95

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Pyridoxal phosphate

Pubmed 12517848

 

prodomImg

pubmed

5

361

S=851 I=46 E=2.41842e-94

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Pyridoxal phosphate

Pubmed 12517848

 

prodomImg

pubmed

1

361

S=840 I=46 E=4.85388e-93

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Cytoplasm Pyridoxal phosphate Pyridoxine

Pubmed 3518706

 

prodomImg

pubmed

1

361

S=838 I=47 E=8.55484e-93

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Cytoplasm Pyridoxal phosphate Pyridoxine

Pubmed 2198540,2045774

 

prodomImg

sp_Pdown

sp|Q3BUZ3|SERC_XANC5

1

361

S=1702 I=91 E=0

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Cytoplasm Pyridoxal phosphate Pyridoxine

sp_Pdown

sp|Q8PLY7|SERC_XANAC

1

361

S=1700 I=91 E=0

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Cytoplasm Pyridoxal phosphate Pyridoxine

sp_Pdown

sp|B2SJJ1|SERC_XANOP

1

361

S=1671 I=88 E=0

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Cytoplasm Pyridoxal phosphate Pyridoxine

sp_Pdown

sp|Q5H079|SERC_XANOR

1

361

S=1670 I=88 E=0

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Cytoplasm Pyridoxal phosphate Pyridoxine

sp_Pdown

sp|Q2P354|SERC_XANOM

1

361

S=1670 I=88 E=0

Phosphoserine aminotransferase EC=2.6.1.52 ; Amino-acid biosynthesis Cytoplasm Pyridoxal phosphate Pyridoxine

Iprscan IPR015421 [G3DSA:3.40.640.10]

3

254

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan IPR015422 [G3DSA:3.90.1150.10]

257

361

Pyridoxal phosphate-dependent transferase, major region, subdomain 2

Iprscan [PIRSF000525]

1

361

-

Iprscan [PTHR21152:SF1]

1

360

-

Iprscan [PTHR21152]

1

360

-

Iprscan IPR000192 [PF00266]

5

344

Aminotransferase, class V/Cysteine desulfurase

Iprscan IPR003248 [TIGR01364]

4

360

Phosphoserine aminotransferase

Iprscan [seg]

44

55

-

Iprscan [seg]

317

332

-

PD661108

100

216

S=308 I=50 E=7.13074e-30

PD001544

223

292

S=209 I=51 E=7.24673e-18

PD857926

1

59

S=166 I=53 E=1.10629e-12

PDA1F7O7

58

102

S=124 I=51 E=1.64526e-07

Iprscan IPR015424 [SSF53383]

3

361

Pyridoxal phosphate-dependent transferase, major domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1MHHvL6C)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

52 hits
swiss-prot

Swiss-Prot ncbi-blastp

163 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG0PbUp/XFF4834R_chr28600.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG0PbUp/XFF4834R_chr28600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG0PbUp/XFF4834R_chr28600.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBG0PbUp/XFF4834R_chr28600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.