Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr00340gltDXFF4834R_chr00340probable glutamate synthase subunit beta
  2. XFF4834R_chr00350gltBXFF4834R_chr00350glutamate synthase, large subunit
  3. XFF4834R_chr07360XFF4834R_chr07360putative glutamate-cysteine ligase

gltD XFF4834R_chr00340
XFF4834R_chr00330
XFF4834R_chr00330
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00350
XFF4834R_chr00350
ID gltD
AC XFF4834R_chr00340
LT XFF4834R_chr00340
OR XFF4834R_chr from 38056 to 39537 on strand -
DE probable glutamate synthase subunit beta
IP Adrenodoxin reductase; Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region; Alpha-helical ferredoxin
CL 1.5.1.1 Glutamate GO:0006537
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: glutamate biosynthetic process (GO:0006537)
Molecular Function: iron-sulfur cluster binding (GO:0051536)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: oxidoreductase activity (GO:0016491)
NAD or NADP as acceptor (GO:0016639)

Curated
PM
AN
CC COG: [ER] Amino acid transport and metabolism;General function prediction only;
CC MODEL: acur
CC STATUS: curated by darrasse (20110304)
MW 52734.4 Da
SQ 493 aa
 
........10........20........30........40........50
| | | | |
MSRKQAFQFLDLPRTMPTRIPVELRTSGDWGELYGRFDKADAQYQAGRCL
DCGNPYCSWKCPVHNAIPQWLQLVQENRIEEAAALCHSTNPLPEVCGRVC
PQDRLCEGSCTLEEFGAVTIGAVEKYIVDTAFKMGWRPDLGNVQPSGHRV
AVIGAGPAGLACADRLARAGIEAVVYDRYEQIGGLLQFGIPSFKLDKSVI
GKRREILEGMGVQFRLGVEIGKDISIEQLLAEYDAVFLGTGAYRYTDGGL
PGQDLKNVLPALPFLVQNSRIVSGNDPHGRPIAGWEDQLALPDLTGKRVV
VLGGGDTGMDCVRSAIRLGAAKVTCAYRRDEASMPGSAREVANAREEGVR
FLFNRQPLSIESGADDEAIGVTVVETKLGEPDASGRRNAVPVEGSESLLE
ADVVIIAFGFSPTLPDWLASQGVEAGSNGRIVAPADGNGRLPYQTTNPRL
FAGGDCVRGADLVVTAVAEGRDAAGSIVQLLGVKAQVKEPAAA
XFF4834R

XFF4834R_chr10160 lcl|fadH-XFF4834R_chr10160

142

262

S=111 I=33 E=8.82709e-07

2,4-dienoyl-CoA reductase, NADH and FMN-linked

XFF4834R

XFF4834R_chr10160 lcl|fadH-XFF4834R_chr10160

142

262

S=111 I=33 E=8.82709e-07

2,4-dienoyl-CoA reductase, NADH and FMN-linked

pubmed

4

483

S=1441 I=57 E=1.1486e-165

Glutamate synthase [NADPH] small chain EC=1.4.1.13 ; 4Fe-4S Amino-acid biosynthesis Iron Iron-sulfur Metal-binding Oxidoreductase

Pubmed 3326786

 

prodomImg

pubmed

4

483

S=1436 I=57 E=3.92703e-165

Glutamate synthase small subunit

Pubmed 11673431

 

prodomImg

pubmed

7

483

S=1423 I=58 E=1.6976e-163

GltD

Pubmed 15601726

 

prodomImg

pubmed

7

483

S=1418 I=58 E=7.09286e-163

Glutamate synthase small chain Glutamate synthase small subunit

Pubmed 15175298

 

prodomImg

pubmed

4

483

S=1389 I=57 E=2.23641e-159

Putative glutamate synthase [NADPH] small chain

Pubmed 18328084

 

prodomImg

pubmed

13

483

S=1365 I=56 E=1.77834e-156

Putative oxidoreductase ; 4Fe-4S Iron Iron-sulfur Metal-binding

Pubmed 12379698,15271940

 

prodomImg

pubmed

1

485

S=1332 I=54 E=1.51498e-152

Protein aegA ; 4Fe-4S Iron Iron-sulfur Metal-binding Oxidoreductase Repeat

Pubmed 8955321

 

prodomImg

pubmed

7

483

S=1319 I=55 E=6.49218e-151

Glutamate synthase small subunit gltD

Pubmed 8921877

 

prodomImg

pubmed

1

487

S=952 I=43 E=1.69081e-106

NADPH-dependent glutamate synthase beta chain-related oxidase

Pubmed 18028413

 

prodomImg

pubmed

1

477

S=921 I=44 E=1.01631e-102

Glutamate synthase [NADPH] small chain EC=1.4.1.13 ; 4Fe-4S Amino-acid biosynthesis Iron Iron-sulfur Metal-binding Oxidoreductase

Pubmed 8428988,2198943

 

prodomImg

sp_Pdown

sp|P09832|GLTD_ECOLI

4

483

S=1441 I=57 E=7.90112e-166

Glutamate synthase [NADPH] small chain EC=1.4.1.13 ; 4Fe-4S Amino-acid biosynthesis Iron Iron-sulfur Metal-binding Oxidoreductase

sp_Pdown

sp|P37127|AEGA_ECOLI

1

485

S=1332 I=54 E=1.04215e-152

Protein aegA ; 4Fe-4S Iron Iron-sulfur Metal-binding Oxidoreductase Repeat

sp_Pdown

sp|Q46820|YGFT_ECOLI

30

485

S=1226 I=54 E=8.00581e-140

Uncharacterized protein ygfT ; 4Fe-4S Iron Iron-sulfur Metal-binding Oxidoreductase Repeat

sp_Pdown

sp|Q05756|GLTD_AZOBR

1

477

S=921 I=44 E=6.99114e-103

Glutamate synthase [NADPH] small chain EC=1.4.1.13 ; 4Fe-4S Amino-acid biosynthesis Iron Iron-sulfur Metal-binding Oxidoreductase

sp_Pdown

sp|Q12680|GLT1_YEAST

28

481

S=633 I=35 E=5.70327e-68

Glutamate synthase [NADH] EC=1.4.1.14 ; 3Fe-4S Amino-acid biosynthesis Coiled FAD Flavoprotein FMN Glutamine amidotransferase Iron Iron-sulfur

Iprscan IPR000759 [PR00419]

149

171

Adrenodoxin reductase

Iprscan IPR000759 [PR00419]

172

185

Adrenodoxin reductase

Iprscan IPR000759 [PR00419]

299

313

Adrenodoxin reductase

Iprscan IPR000759 [PR00419]

333

346

Adrenodoxin reductase

Iprscan IPR012285 [G3DSA:1.10.1060.10]

29

151

Fumarate reductase, C-terminal

Iprscan [G3DSA:3.50.50.60]

243

409

-

Iprscan [PTHR11938:SF9]

9

481

-

Iprscan [PTHR11938]

9

481

-

Iprscan IPR013027 [PF07992]

149

459

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR001327 [PF00070]

298

368

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR006006 [TIGR01318]

7

483

Glutamate synthase, NADH/NADPH, small subunit 2

PD149671

14

150

S=377 I=51 E=4.35368e-38

PD453601

236

382

S=222 I=43 E=2.24783e-19

PDA1F5C2

1

40

S=212 I=93 E=3.69175e-18

PDA696N2

96

136

S=164 I=70 E=2.54697e-12

PD070301

185

236

S=156 I=58 E=2.19427e-11

PD857031

46

110

S=154 I=51 E=4.85134e-11

PDA1Q9B9

115

146

S=149 I=81 E=1.99194e-10

PD696384

237

276

S=131 I=63 E=2.53847e-08

PDA2W5Q7

126

148

S=129 I=96 E=4.79719e-08

PDA1T0Y5

352

376

S=124 I=100 E=2.00435e-07

Iprscan [SSF51971]

146

409

-

Iprscan IPR009051 [SSF46548]

7

158

Alpha-helical ferredoxin

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one lG3QMU0d)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

79 hits
swiss-prot

Swiss-Prot ncbi-blastp

35 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr00340.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr00340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr00340.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr00340.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
gltB XFF4834R_chr00350
XFF4834R_chr00340
XFF4834R_chr00340
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr00360
XFF4834R_chr00360
ID gltB
AC XFF4834R_chr00350
LT XFF4834R_chr00350
OR XFF4834R_chr from 39659 to 44131 on strand -
DE glutamate synthase, large subunit
IP Glutamine amidotransferase, class-II; Glutamate synthase, central-N
CL 1.5.1.1 Glutamate GO:0006537
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: nitrogen compound metabolic process (GO:0006807)
Biological Process: metabolic process (GO:0008152)
Biological Process: glutamate biosynthetic process (GO:0006537)
Molecular Function: glutamate synthase activity (GO:0015930)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20101013)
MW 162763.4 Da
SQ 1490 aa
 
........10........20........30........40........50
| | | | |
MAPRTRQGLNDDGLYNSVRDERDACGFGMVAQLDDQPSRALVDTAIAALS
RMTHRGGVAADGLTGDGCGLLIRKPDAFLRGLARDAGITLGTRYAAGVVF
LPLDEADAARCRAELEAQLHSAGVHLRGWRVVPTDDSVCGQLARDTLPRI
EQVFVDAGAEQTEDGFTLALFLARRRAEQALHAVENFYVTTLSPNGISYK
GMVLPDKLSTFYPDLQRSDLSSSAIVFHQRFSTNTLPRWPLAHPFRLLAH
NGEINTIEGNRRWAQARSKVWQTPRFDIAQFDPVISMHGSDSQSLDNMLE
LLIAGGMDLLQALRILVPPATQSLEFKDADLAAFYEFYGLNTEPWDGPAG
IVACDSRYAACMLDRNGLRPARWMLTSDRHFLVASEAGVWELPAERITRK
GKLGPGEMMAIDLKRGDLLDSDAIDRINRARAPYKQWLQQGVTYLQTELI
DPSLVEEPFSEQTLRSYHKLFQLSTEEVEQVLRPLAETEQEATGSMGDDT
PMAVLSRQTRPLYDYFRQAFAQVTNPPIDPLREGIAMSLTTQLGKETNIF
HAGAETVNHVILNSPVLSQRKLRQLLKMEQYVERNRLIDLSYSLEEGLKA
GLERICQEVEAAARAGAVMLLLSDRYPVPDRPMAHALLATGAVHHHLCKV
GLRCDVNLIIETGTARDPHHMACLLGVGATAVYPYLAYQTLFDLGRRGIL
QLSKGGEQSQIGRRYRKGIYKGLSKIISKMGICTIASYRGAQLFEIVGLD
PDVVDLCFADTPARIGGVDLARLDTEARELTVRAWNDQLKPEVGGLLKYV
HGGEYHMYNPDVVMTLQRATRTGDAGDWQKYVDAVHARPASTLRDLVQLK
RADTPTPLDDVAPAEDVLRRFDSAAISLGALSPEAHEALAIAMNRLGGRS
NSGEGGEDPARYGTEKRSKIKQVASGRFGVTPEYLVNAEVLQIKVAQGAK
PGEGGQLPGHKVNELIARLRYAKPGIGLISPPPHHDIYSIEDLAQLIYDL
KQVNPTALVSVKLVAHAGVGTIAAGVVKAGADLITVSGHDGGTGASPVSS
IRYAGVPWELGVAESHQALVANDLRERTILQTDGGLKTGLDVVKAALLGA
DSFGFGTAPMIVLGCKYLRICHLNNCATGVATQDERLRAGYFTGLPERVE
HFFRLLAEEVRQWLSYLGVRSLDEIVGRTDLLEQLDVSPRPGVKVDLSRL
LTHAQYDGSHCAAQRLYESPDSLATQMDGLLADAIANKRGGDHRFLIHNT
DRSIGARLSGAIARAHGNHGMSDAPLNLRFRGTAGQSFGAFNAGGLQLEL
EGEANDYVGKGMAGGRLVVRPPRGARFEARNTPIVGNTCLYGATGGELFA
AGRAGERFAVRNSGALAVLEGAGDHCCEYMTDGVVLVLGKVGLNFGAGFT
GGLAYVLDIERDFVDRYNHELIDIHRVSAEGFENHRQHLHTLISRHRELT
GSIWAQQILDEFRDYIGKFWLVKPKAASIESLTESLRRAA
XFF4834R

NP_640389.1 lcl|gltB-XAC0033

1

1490

S=7798 I=99 E=0

glutamate synthase subunit alpha

XFF4834R

YP_361768.1 lcl|gltB-XCV0037

1

1490

S=7722 I=98 E=0

glutamate synthase subunit alpha

XFF4834R

NP_635427.1 lcl|gltB-XCC0032

1

1490

S=7664 I=97 E=0

glutamate synthase subunit alpha

XFF4834R

lcl|gltB-XALc_3110

9

1490

S=6937 I=88 E=0

probable glutamate synthase, alpha subunit protein

XFF4834R

lcl|gltB-XALc_1694

871

1136

S=315 I=34 E=2.04413e-30

putative ferredoxin-dependent_glutamate_synthase protein

pubmed

13

1487

S=4391 I=57 E=0

GltB

Pubmed 15601726

 

prodomImg

pubmed

13

1487

S=4380 I=58 E=0

Glutamate synthase large subunit

Pubmed 15175298

 

prodomImg

pubmed

4

1482

S=4072 I=54 E=0

Putative glutamate synthase [NADPH] large chain

Pubmed 18328084

 

prodomImg

pubmed

21

1490

S=4012 I=53 E=0

Glutamate synthase large subunit

Pubmed 11673431

 

prodomImg

pubmed

12

1490

S=3943 I=53 E=0

Glutamate synthase [NADPH] large chain EC=1.4.1.13 ; 3Fe-4S Amino-acid biosynthesis FAD Flavoprotein FMN Glutamine amidotransferase Iron Iron

Pubmed 3326786

 

prodomImg

pubmed

16

1476

S=3149 I=45 E=0

Ferredoxin-dependent glutamate synthase, chloroplastic EC=1.4.7.1 ; 3Fe-4S Amino-acid biosynthesis FAD Flavoprotein FMN Glutamine amidotransferase Iron

Pubmed 1989968

 

prodomImg

pubmed

18

1476

S=3141 I=45 E=0

Ferredoxin-dependent glutamate synthase 1, chloroplastic EC=1.4.7.1 ; 3Fe-4S Alternative splicing Amino-acid biosynthesis FAD Flavoprotein FMN

Pubmed 9057836,9596633

 

prodomImg

pubmed

18

1476

S=3117 I=44 E=0

Ferredoxin-dependent glutamate synthase 2, chloroplastic EC=1.4.7.1 ; 3Fe-4S Amino-acid biosynthesis FAD Flavoprotein FMN Glutamine amidotran

Pubmed 9596633

 

prodomImg

pubmed

18

1476

S=3103 I=45 E=0

Ferredoxin-dependent glutamate synthase EC=1.4.7.1 ; Oxidoreductase

Pubmed 16034598

 

prodomImg

pubmed

25

1476

S=3086 I=44 E=0

Ferredoxin-dependent glutamate synthase, chloroplastic EC=1.4.7.1 ; 3Fe-4S Amino-acid biosynthesis FAD Flavoprotein FMN Glutamine amidotransferase Iron Iron-

Pubmed 8286406

 

prodomImg

sp_Pdown

sp|P09831|GLTB_ECOLI

12

1490

S=3943 I=53 E=0

Glutamate synthase [NADPH] large chain EC=1.4.1.13 ; 3Fe-4S Amino-acid biosynthesis FAD Flavoprotein FMN Glutamine amidotransferase Iron Iron

sp_Pdown

sp|P23225|GLTB_MAIZE

16

1476

S=3149 I=45 E=0

Ferredoxin-dependent glutamate synthase, chloroplastic EC=1.4.7.1 ; 3Fe-4S Amino-acid biosynthesis FAD Flavoprotein FMN Glutamine amidotransferase Iron

sp_Pdown

sp|Q9ZNZ7|GLTB1_ARATH

18

1476

S=3141 I=45 E=0

Ferredoxin-dependent glutamate synthase 1, chloroplastic EC=1.4.7.1 ; 3Fe-4S Alternative splicing Amino-acid biosynthesis FAD Flavoprotein FMN

sp_Pdown

sp|P51375|GLTB_PORPU

17

1480

S=3133 I=44 E=0

Ferredoxin-dependent glutamate synthase EC=1.4.7.1 ; 3Fe-4S Amino-acid biosynthesis Chloroplast FAD Flavoprotein FMN Glutamine amidotransferase Iron Iron-sulfur

sp_Pdown

sp|Q9T0P4|GLTB2_ARATH

18

1476

S=3117 I=44 E=0

Ferredoxin-dependent glutamate synthase 2, chloroplastic EC=1.4.7.1 ; 3Fe-4S Amino-acid biosynthesis FAD Flavoprotein FMN Glutamine amidotran

Iprscan [G3DSA:3.60.20.10]

25

441

-

Iprscan IPR013785 [G3DSA:3.20.20.70]

444

798

Aldolase-type TIM barrel

Iprscan IPR013785 [G3DSA:3.20.20.70]

798

1201

Aldolase-type TIM barrel

Iprscan IPR002489 [G3DSA:2.160.20.60]

1223

1481

Glutamate synthase, alpha subunit, C-terminal

Iprscan IPR000583 [PF00310]

25

387

Glutamine amidotransferase, class-II

Iprscan IPR006982 [PF04898]

464

751

Glutamate synthase, central-N

Iprscan IPR002932 [PF01645]

806

1170

Glutamate synthase, central-C

Iprscan IPR002489 [PF01493]

1243

1442

Glutamate synthase, alpha subunit, C-terminal

Iprscan IPR017932 [PS51278]

25

414

Glutamine amidotransferase, type II

Iprscan [seg]

1383

1393

-

PD188236

1234

1474

S=644 I=56 E=2.78311e-70

PD002671

940

1065

S=490 I=72 E=1.15551e-51

PD581617

566

770

S=476 I=51 E=6.32094e-50

PD003387

197

312

S=372 I=58 E=2.33449e-37

PD282830

312

445

S=330 I=46 E=2.86586e-32

PD869886

1162

1227

S=305 I=85 E=2.68943e-29

PD002943

466

567

S=290 I=55 E=1.76678e-27

PD882649

768

873

S=234 I=42 E=1.19685e-20

PD572830

874

935

S=227 I=73 E=8.58595e-20

PD682097

94

203

S=188 I=39 E=4.07495e-15

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Ia1ZWrae)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

84 hits
swiss-prot

Swiss-Prot ncbi-blastp

19 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr00350.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr00350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr00350.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr00350.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr07360
XFF4834R_chr_0806
XFF4834R_chr_0806
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07370
XFF4834R_chr07370
ID
AC XFF4834R_chr07360
LT XFF4834R_chr07360
OR XFF4834R_chr from 851217 to 852635 on strand +
DE putative glutamate-cysteine ligase
IP Glutamate--cysteine ligase, GCS2; Glutamate--cysteine ligase, plant
CL 1.5.1.1 Glutamate GO:0006537
EC
GO InterPro
Biological Process: glutathione biosynthetic process (GO:0006750)
Molecular Function: glutamate-cysteine ligase activity (GO:0004357)

Curated
PM
AN
CC COG: [H] Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100330)
MW 52687.1 Da
SQ 472 aa
 
........10........20........30........40........50
| | | | |
MAGEYPHIVRPLSFASLPLSSPSHVAETPITERAELAQVLASGEKPSADW
RIGTEHEKFGFQLDDLRAPTFGGARGIEALLTGLTRFGWEPVQENGRTIA
LLRDGASVTLEPAGQLELSGAAVETLHHTCVETGTHLDEVAQVAGELQLG
FLGMGFQPKWRRDQMPWMPKGRYQIMKNYMPKVGSLGLDMMTRTCTVQVN
LDYATEADMVKKFRVSLALQPIATALFADSPFTDGKPNGYLSYRSHIWTD
TDADRTGMLDFVFEDGFGYDRYVDYLLDVPMYFSYRDGVYHDASGQSFRD
FMQGKLPALPGALPTFRDWSDHMTTAFPEVRLKKYLEMRGADAGPWDRLC
ALSAFWVGLLYDQTALDAAWDLVRDFSPTERHALRDGVPKHALGLPFRTG
TARDLAVEAVNIAREGLRRRARLNRDGQDETGFLDVIAEIAESGVTAAER
KLALYHGAWNGDIDRVFREFAY
XFF4834R

YP_362513.1 lcl|gsh1-XCV0782

1

472

S=2282 I=92 E=0

glutamate-cysteine ligase

XFF4834R

NP_641081.1 lcl|gsh1-XAC0728

24

472

S=2279 I=96 E=0

glutamate-cysteine ligase precursor

XFF4834R

NP_638742.1 lcl|gsh1-XCC3396

24

472

S=2144 I=90 E=0

glutamate-cysteine ligase precursor

XFF4834R

lcl|XALc_0856

1

472

S=1914 I=80 E=0

putative glutamate cystein ligase protein

pubmed

25

472

S=1392 I=58 E=9.08811e-160

Glutamate--cysteine ligase, chloroplastic EC=6.3.2.2 ; ATP-binding Disulfide bond Glutathione biosynthesis Nucleotide-binding Plastid Transit pep

Pubmed 9620267,9119067

 

prodomImg

pubmed

25

472

S=1369 I=57 E=4.513e-157

Glutamate--cysteine ligase, chloroplastic EC=6.3.2.2 ; Alternative splicing ATP-binding Disulfide bond Glutathione biosynthesis Nucleotide-binding

Pubmed 7937837,9807829

 

prodomImg

pubmed

25

472

S=1369 I=57 E=5.56341e-157

Gamma-glutamylcysteine synthetase ; Transit peptide

Pubmed 10557236

 

prodomImg

pubmed

25

472

S=1363 I=57 E=2.44933e-156

Gamma-glutamylcysteine synthetase EC=6.3.2.2 ; Ligase

Pubmed 16301210

 

prodomImg

pubmed

25

472

S=1362 I=57 E=3.23754e-156

Glutamate--cysteine ligase, chloroplastic EC=6.3.2.2 ; ATP-binding Disulfide bond Glutathione biosynthesis Nucleotide-binding Plastid Transit peptide

Pubmed 10694062

 

prodomImg

pubmed

25

472

S=1361 I=57 E=4.66927e-156

Gamma-glutamylcysteine synthetase

Pubmed 14601672

 

prodomImg

pubmed

25

472

S=1360 I=57 E=6.22592e-156

Gamma-glutamylcysteine synthetase ; Transit peptide

Pubmed 10557236

 

prodomImg

pubmed

29

472

S=1340 I=57 E=1.75417e-153

Glutamate--cysteine ligase A, chloroplastic EC=6.3.2.2 ; ATP-binding Disulfide bond Glutathione biosynthesis Nucleotide-binding Plastid Tran

Pubmed 16261349

 

prodomImg

pubmed

29

472

S=1333 I=56 E=1.15334e-152

Putative gamma-glutamylcysteine synthetase EC=6.3.2.2 ; Ligase

Pubmed 15047902

 

prodomImg

pubmed

48

390

S=1112 I=60 E=7.75077e-126

Putative glutathione synthetase GshA

Pubmed 8825087

 

prodomImg

sp_Pdown

sp|O23736|GSH1_BRAJU

25

472

S=1392 I=58 E=6.25343e-160

Glutamate--cysteine ligase, chloroplastic EC=6.3.2.2 ; ATP-binding Disulfide bond Glutathione biosynthesis Nucleotide-binding Plastid Transit pep

sp_Pdown

sp|P46309|GSH1_ARATH

25

472

S=1369 I=57 E=3.10535e-157

Glutamate--cysteine ligase, chloroplastic EC=6.3.2.2 ; Alternative splicing ATP-binding Disulfide bond Glutathione biosynthesis Nucleotide-binding

sp_Pdown

sp|Q9ZNX6|GSH1_MEDTR

25

472

S=1362 I=57 E=2.22772e-156

Glutamate--cysteine ligase, chloroplastic EC=6.3.2.2 ; ATP-binding Disulfide bond Glutathione biosynthesis Nucleotide-binding Plastid Transit peptide

sp_Pdown

sp|Q1W2L8|GSH1_TOBAC

25

472

S=1353 I=57 E=2.84132e-155

Glutamate--cysteine ligase, chloroplastic EC=6.3.2.2 ; ATP-binding Disulfide bond Glutathione biosynthesis Nucleotide-binding Plastid Transit peptide

sp_Pdown

sp|O22493|GSH1_SOLLC

25

472

S=1351 I=57 E=4.79413e-155

Glutamate--cysteine ligase, chloroplastic EC=6.3.2.2 ; ATP-binding Disulfide bond Glutathione biosynthesis Nucleotide-binding Plastid Transit peptide

Iprscan IPR006336 [PF04107]

77

375

Glutamate--cysteine ligase, GCS2

Iprscan IPR011556 [TIGR01436]

29

472

Glutamate--cysteine ligase, plant

Iprscan [seg]

11

23

-

Iprscan [seg]

413

425

-

PD526943

314

472

S=434 I=55 E=4.81935e-45

PD284755

29

121

S=296 I=63 E=2.86554e-28

PD014390

182

242

S=294 I=87 E=4.13275e-28

PDA1G240

123

181

S=246 I=64 E=2.7776e-22

PDA1G292

243

279

S=159 I=81 E=1.04563e-11

PDA1G2G2

280

311

S=146 I=81 E=3.8636e-10

PDA1Y481

426

472

S=137 I=55 E=5.19243e-09

PD885126

426

472

S=127 I=51 E=8.09318e-08

PDA5L7C3

243

306

S=114 I=36 E=2.62383e-06

PDA1T6B4

450

472

S=110 I=91 E=8.5136e-06

Iprscan [SSF55931]

41

471

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 87qCjpt2)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

9 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr07360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr07360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr07360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqmZjzc/XFF4834R_chr07360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.