Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr02460XFF4834R_chr02580677_0289195_f2_XFF4834R-XFF4834R_chr02460XFF4834R_chr02460Putative cytochrome c family protein
  2. XFF4834R_chr12250XFF4834R_chr12910306_1387755_f1_XFF4834R-XFF4834R_chr12250XFF4834R_chr12250Putative electron transfer protein azurin I
  3. XFF4834R_chr17360XFF4834R_chr18520017_1987024_f2_XFF4834R-XFF4834R_chr17360XFF4834R_chr17360putative alcohol dehydrogenase
  4. XFF4834R_chr24890XFF4834R_chr27210568_2873569_f2_XFF4834R-XFF4834R_chr24890XFF4834R_chr24890Probable alcohol dehydrogenase

XFF4834R_chr02580677_0289195_f2_XFF4834R-XFF4834R_chr02460 XFF4834R_chr02460
XFF4834R_chr02450
XFF4834R_chr02450
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02470
XFF4834R_chr02470
ID XFF4834R_chr02580677_0289195_f2_XFF4834R-XFF4834R_chr02460
AC XFF4834R_chr02460
LT XFF4834R_chr02460
OR XFF4834R_chr from 288677 to 289195 on strand +
DE Putative cytochrome c family protein
IP Cytochrome c, class I
CL 1.4.1 Electron donor GO:0009053
EC
GO InterPro
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: heme binding (GO:0020037)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100503)
MW 17966.5 Da
SQ 172 aa
 
........10........20........30........40........50
| | | | |
MRNYDLEFLKKFSMVIGLLVVITLGLIALAAYLQRAIPDEVSPTAAKRVL
QRIAPVGAVYAGATGASAQAAAQAAALAKAASQSAYGGTTDGKTIFNNLC
TACHTTGVGKAPTLDHSHWDARIAQGKDTLYKHAIEGYTGPDGGIMPPKG
GNPALTEEQVRATVDWMLGNLK
X.species

NP_640629.1 lcl|XAC0273-XAC0273

1

172

S=635 I=73 E=2.97248e-70

cytochrome C5

X.species

YP_362012.1 lcl|XCV0281

1

172

S=628 I=72 E=2.15108e-69

putative cytochrome c

X.species

NP_635649.1 lcl|XCC0254

1

172

S=605 I=69 E=1.20686e-66

cytochrome C5

X.species

lcl|XALc_0152

1

172

S=556 I=63 E=1.06285e-60

putative cytochrome c precursor protein

pubmed

92

172

S=163 I=41 E=1.74921e-11

Cytochrome c-555 ; Electron transport Heme Iron Metal-binding Photosynthesis

Pubmed 188412,202947

 

prodomImg

pubmed

91

171

S=151 I=38 E=4.36578e-10

Cytochrome c-555 ; Electron transport Heme Iron Metal-binding Photosynthesis

Pubmed 188412

 

prodomImg

pubmed

88

167

S=131 I=33 E=1.04229e-07

Probable cytochrome C

Pubmed 16514165

 

prodomImg

pubmed

91

167

S=123 I=36 E=1.09735e-06

Soluble cytochrome cA

Pubmed 10781566

 

prodomImg

pubmed

91

167

S=122 I=35 E=1.26162e-06

Mono-heme c-type cytochrome ScyA

Pubmed 11955059

 

prodomImg

pubmed

91

167

S=119 I=36 E=3.2633e-06

Cytochrome c Cytochrome c, class I ; Signal

Pubmed 17142390

 

prodomImg

sp

92

172

S=176 I=45 E=3.18063e-13

Cytochrome c-555 ; Electron transport Heme Iron Metal-binding Photosynthesis Signal

 

prodomImg

sp

92

172

S=163 I=41 E=1.21695e-11

Cytochrome c-555 ; Electron transport Heme Iron Metal-binding Photosynthesis

 

prodomImg

sp

91

171

S=151 I=38 E=3.03733e-10

Cytochrome c-555 ; Electron transport Heme Iron Metal-binding Photosynthesis

 

prodomImg

PD872872

91

171

S=181 I=45 E=1.77425e-14

PD693581

1

55

S=180 I=65 E=2.58128e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one I0HpBVlv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

6 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr02460.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr02460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr02460.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr02460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr12910306_1387755_f1_XFF4834R-XFF4834R_chr12250 XFF4834R_chr12250
XFF4834R_chr12240
XFF4834R_chr12240
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr12260
XFF4834R_chr12260
ID XFF4834R_chr12910306_1387755_f1_XFF4834R-XFF4834R_chr12250
AC XFF4834R_chr12250
LT XFF4834R_chr12250
OR XFF4834R_chr from 1387306 to 1387755 on strand +
DE Putative electron transfer protein azurin I
IP Cupredoxin; Azurin, proteobacteria
CL 1.4.1 Electron donor GO:0009053
EC
GO InterPro
Molecular Function: copper ion binding (GO:0005507)
Molecular Function: electron carrier activity (GO:0009055)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100817)
MW 15885.3 Da
SQ 149 aa
 
........10........20........30........40........50
| | | | |
MKLFSTIAMCALALIAPTAWARTCAVTITGNDQMKFDQSTIKLAPECTQV
ELTLKHSGKMAATVMGHNWVLTKSADFQAVANAGVRSTIADSYLPKADAR
VIAHTKVIGGGDSTTVSFPTSKLSKGADYTFFCSFPGHWAMMKGTLTFG
Show or not Domain decomposition
 
X.species

NP_643729.1 lcl|az1-XAC3422

1

149

S=775 I=98 E=2.31962e-87

electron transfer protein azurin I

X.species

YP_365268.1 lcl|XCV3537

15

149

S=708 I=99 E=2.91576e-79

putative electron transfer protein azurin I

X.species

NP_638620.1 lcl|az1-XCC3274

1

149

S=657 I=82 E=5.06888e-73

electron transfer protein azurin I

pubmed

3

148

S=430 I=54 E=5.15246e-44

Azurin ; Signal

Pubmed 11440141

 

prodomImg

pubmed

1

148

S=422 I=52 E=5.76602e-43

Azurin I ; Signal

Pubmed 16832626

 

prodomImg

pubmed

24

148

S=400 I=55 E=2.26273e-40

Azurin-1 ; Copper Disulfide bond Electron transport Metal-binding Periplasm

Pubmed 9761902

 

prodomImg

pubmed

5

148

S=378 I=51 E=9.77327e-38

Azurin ; Copper Disulfide bond Electron transport Metal-binding Periplasm Signal

Pubmed 2116366,6842609

 

prodomImg

pubmed

24

149

S=376 I=54 E=1.96318e-37

Azurin-2 ; Copper Disulfide bond Electron transport Metal-binding Periplasm

Pubmed 7640272,15299774

 

prodomImg

sp

24

148

S=409 I=56 E=1.50207e-41

Azurin ; Copper Disulfide bond Electron transport Metal-binding Periplasm

 

prodomImg

sp

8

148

S=406 I=51 E=2.93935e-41

Azurin ; Copper Disulfide bond Electron transport Metal-binding Periplasm Signal

 

prodomImg

sp

8

148

S=406 I=51 E=2.93935e-41

Azurin ; Copper Disulfide bond Electron transport Metal-binding Periplasm Signal

 

prodomImg

sp

8

148

S=406 I=51 E=2.93935e-41

Azurin ; Copper Disulfide bond Electron transport Metal-binding Periplasm Signal

 

prodomImg

sp

24

148

S=400 I=55 E=1.56769e-40

Azurin-1 ; Copper Disulfide bond Electron transport Metal-binding Periplasm

 

prodomImg

Iprscan IPR008972 [G3DSA:2.60.40.420]

22

149

Cupredoxin

Iprscan IPR000923 [PF00127]

23

147

Blue (type 1) copper domain

Iprscan IPR014068 [TIGR02695]

24

148

Azurin, proteobacteria

Iprscan IPR000923 [PS00196]

126

142

Blue (type 1) copper domain

Iprscan [SignalP-NN(euk)]

1

21

-

PD003655

26

149

S=408 I=61 E=4.97335e-42

PDA4U7N1

1

25

S=112 I=88 E=4.34665e-06

Iprscan IPR008972 [SSF49503]

22

149

Cupredoxin

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one tmPC4TN6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

24 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr12250.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr12250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr12250.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr12250.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr18520017_1987024_f2_XFF4834R-XFF4834R_chr17360 XFF4834R_chr17360
XFF4834R_chr_1862
XFF4834R_chr_1862
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17370
XFF4834R_chr17370
ID XFF4834R_chr18520017_1987024_f2_XFF4834R-XFF4834R_chr17360
AC XFF4834R_chr17360
LT XFF4834R_chr17360
OR XFF4834R_chr from 1986017 to 1987024 on strand +
DE putative alcohol dehydrogenase
IP Alcohol dehydrogenase superfamily, zinc-containing; Polyketide synthase, enoylreductase
CL 1.4.1 Electron donor GO:0009053
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [CR] Energy production and conversion;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100818)
MW 34962.5 Da
SQ 335 aa
 
........10........20........30........40........50
| | | | |
MQAIRLRHPAAIASLQSVALPDPGQPARGQIRVRLHASSLNFHDLGVVLG
QMPTADGRIPMSDGAGVVEAVGPEVDEFAVGDHVVSTFFPQWLDGEPLHA
GFATTPGDGVDGYARSAVVADAQAFTHAPRGYSHAEAATLTTAGVTAWRA
LAVNGGLKAGDSVLVLGTGGVSIFALQLAKAMGARVIATSSSDEKLEKVR
ALGADHLINYRQHPEWSAQVLDITERRGVDHVVEVGGPGTLTQSIRAARV
GGHIALIGVLTGAAGPVPTAEMMGRQQRLQGLVVGSRKHQQDLVRALDSL
PLRPVIDRSFALDEIGEAFALQKSGGHLGKIALAF
XFF4834R

XFF4834R_chr01690 lcl|XFF4834R_chr01850374_0207384_f1_XFF4834R-XFF4834R_chr01690

1

335

S=442 I=37 E=5.25234e-47

XFF4834R

XFF4834R_chr07970 lcl|qorA-XFF4834R_chr07970

14

333

S=197 I=29 E=2.37826e-17

quinone oxidoreductase, NADPH-dependent

XFF4834R

XFF4834R_chr24890 lcl|XFF4834R_chr27210568_2873569_f2_XFF4834R-XFF4834R_chr24890

129

263

S=147 I=34 E=3.02069e-11

XFF4834R

XFF4834R_chr10170 lcl|XFF4834R_chr10690144_1153166_r2_XFF4834R-XFF4834R_chr10170

14

212

S=137 I=31 E=4.46824e-10

XFF4834R

XFF4834R_chr10280 lcl|tdh-XFF4834R_chr10280

160

335

S=125 I=25 E=1.41121e-08

threonine 3-dehydrogenase, NAD(P)-binding

XFF4834R

XFF4834R_chr07420 lcl|frmA-XFF4834R_chr07420

136

325

S=122 I=28 E=2.50901e-08

alcohol dehydrogenase class III/glutathione-dependent formaldehyde dehydrogenase

XFF4834R

XFF4834R_chr06610 lcl|XFF4834R_chr_0753670_0754776_f1_XFF4834R-XFF4834R_chr06610

136

319

S=105 I=29 E=3.77348e-06

XFF4834R

XFF4834R_chr21310 lcl|XFF4834R_chr23210834_2474003_f3_XFF4834R-XFF4834R_chr21310

120

237

S=100 I=32 E=1.26784e-05

X.species

NP_643205.1 lcl|XAC2896-XAC2896

1

335

S=1587 I=94 E=0

alcohol dehydrogenase

X.species

YP_364778.1 lcl|XCV3047

1

335

S=1575 I=93 E=0

putative alcohol dehydrogenase

X.species

NP_638078.1 lcl|XCC2730

1

335

S=1434 I=84 E=1.2403e-166

alcohol dehydrogenase

X.species

NP_640557.1 lcl|adh-XAC0201

1

333

S=438 I=38 E=5.34304e-46

alcohol dehydrogenase

X.species

YP_361916.1 lcl|XCV0185

20

333

S=418 I=38 E=1.5319e-43

putative alcohol dehydrogenase

X.species

NP_636133.1 lcl|XCC0742

1

333

S=205 I=30 E=1.05765e-17

quinone reductase

X.species

YP_362575.1 lcl|XCV0844

1

333

S=194 I=29 E=1.91188e-16

putative quinone oxidoreductase

X.species

NP_641146.1 lcl|XAC0794-XAC0794

1

333

S=192 I=29 E=3.34038e-16

quinone reductase

X.species

lcl|XALc_1049

14

335

S=168 I=26 E=2.82335e-13

putative zinc-containing alcohol dehydrogenase superfamily protein

X.species

NP_636320.1 lcl|XCC0934

1

222

S=149 I=31 E=5.05516e-11

oxidoreductase

pubmed

21

335

S=669 I=45 E=2.40841e-72

Putative alcohol dehydrogenase zinc-binding domain protein

Pubmed 20091296

 

prodomImg

pubmed

21

333

S=505 I=39 E=1.93815e-52

Alcohol dehydrogenase

Pubmed 20146797

 

prodomImg

pubmed

21

333

S=480 I=37 E=1.95023e-49

NADPH:quinone reductase or related Zn-dependent oxidoreductase Zinc-binding alcohol dehydrogenase

Pubmed 18004300

 

prodomImg

pubmed

160

335

S=367 I=49 E=8.71839e-36

Putative formaldehyde dehydrogenase

Pubmed 15743951,9501423

 

prodomImg

pubmed

112

333

S=285 I=35 E=8.72159e-26

Zn-dependent alcohol dehydrogenase

Pubmed 20132279

 

prodomImg

sp

23

333

S=531 I=39 E=7.7681e-56

Zinc-type alcohol dehydrogenase-like protein C1773.06c EC=1.-.-.- ; Cytoplasm Oxidoreductase

 

prodomImg

sp

25

333

S=277 I=29 E=5.34086e-25

Uncharacterized zinc-type alcohol dehydrogenase-like protein yogA EC=1.-.-.- ; Oxidoreductase

 

prodomImg

sp

107

335

S=217 I=31 E=9.44022e-18

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

 

prodomImg

sp

93

335

S=210 I=31 E=6.77224e-17

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

 

prodomImg

sp

107

333

S=209 I=32 E=8.3485e-17

Alcohol dehydrogenase EC=1.1.1.1 ; Metal-binding NAD Oxidoreductase Zinc

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

122

310

NAD(P)-binding domain

Iprscan [PTHR11695:SF21]

14

333

-

Iprscan IPR002085 [PTHR11695]

14

333

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan IPR013149 [PF00107]

170

295

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

29

88

Alcohol dehydrogenase GroES-like

Iprscan IPR020843 [SM00829]

13

333

Polyketide synthase, enoylreductase

Iprscan [seg]

63

77

-

Iprscan [SignalP-NN(euk)]

1

21

-

PDA6N3V8

8

51

S=212 I=95 E=3.61659e-18

PD892560

92

138

S=190 I=81 E=1.76489e-15

PD948077

189

333

S=188 I=31 E=2.97789e-15

PD698911

237

285

S=171 I=69 E=3.27216e-13

PDA1I513

188

236

S=140 I=59 E=2.03663e-09

PDA6N4A8

188

215

S=133 I=89 E=1.48674e-08

PD715891

146

262

S=130 I=37 E=3.2022e-08

PDA2P0H2

188

298

S=128 I=32 E=4.99528e-08

PDA314Q3

232

297

S=120 I=41 E=5.39853e-07

PDA4B1R4

230

333

S=116 I=29 E=1.60542e-06

Iprscan IPR016040 [SSF51735]

133

302

NAD(P)-binding domain

Iprscan IPR011032 [SSF50129]

1

163

GroES-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0vHtbUyk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

310 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr17360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr17360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr17360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr17360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr27210568_2873569_f2_XFF4834R-XFF4834R_chr24890 XFF4834R_chr24890
XFF4834R_chr24880
XFF4834R_chr24880
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24900
XFF4834R_chr24900
ID XFF4834R_chr27210568_2873569_f2_XFF4834R-XFF4834R_chr24890
AC XFF4834R_chr24890
LT XFF4834R_chr24890
OR XFF4834R_chr from 2872568 to 2873569 on strand +
DE Probable alcohol dehydrogenase
IP Alcohol dehydrogenase superfamily, zinc-containing; Polyketide synthase, enoylreductase
CL 1.4.1 Electron donor GO:0009053
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Molecular Function: binding (GO:0005488)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [CR] Energy production and conversion;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100818)
MW 35912.5 Da
SQ 333 aa
 
........10........20........30........40........50
| | | | |
MKALTFKRYGKSPDIGFSERARPTLQPDELLVEVHAAGVNPIDNMIPTGI
FKPVLKFELPATLGSDVAGIVIDVGSRVTRFKRGDAIFASVFDLGRGTIA
EYVAVPESAAALKPANLDFVQAASLPMVALTSWQALKERADLQPGEKVFI
PAGSGGIGTIAIQLAKHLGATVGTTTSTGNVALVNSLGADEVIDYRQQDF
ETVLRGYDIALGTMRGDTIEKSLAILKPGGRIVSLVGPLDAAFARARRLN
VVLQFVFAMMSRKIIRLANKHNVAYSFLFVRPNGTQLAKIGELLEAERIR
PVIDKVFAFEQAKQALEYLAQGRAKGKVVVKIR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr10170 lcl|XFF4834R_chr10690144_1153166_r2_XFF4834R-XFF4834R_chr10170

29

238

S=276 I=36 E=6.26468e-27

XFF4834R

XFF4834R_chr07970 lcl|qorA-XFF4834R_chr07970

18

332

S=275 I=31 E=8.06691e-27

quinone oxidoreductase, NADPH-dependent

XFF4834R

XFF4834R_chr01690 lcl|XFF4834R_chr01850374_0207384_f1_XFF4834R-XFF4834R_chr01690

97

331

S=172 I=31 E=2.63698e-14

XFF4834R

XFF4834R_chr17360 lcl|XFF4834R_chr18520017_1987024_f2_XFF4834R-XFF4834R_chr17360

29

330

S=151 I=27 E=7.76082e-12

XFF4834R

XFF4834R_chr02610 lcl|XFF4834R_chr02730242_0304270_r3_XFF4834R-XFF4834R_chr02610

127

332

S=100 I=27 E=1.45931e-05

predicted oxidoreductase, Zn-dependent and NAD(P)-binding

XFF4834R

XFF4834R_chr07420 lcl|frmA-XFF4834R_chr07420

79

199

S=98 I=31 E=2.19843e-05

alcohol dehydrogenase class III/glutathione-dependent formaldehyde dehydrogenase

X.species

NP_636133.1 lcl|XCC0742

19

332

S=290 I=33 E=5.36093e-28

quinone reductase

X.species

NP_641358.1 lcl|XAC1011-XAC1011

29

238

S=276 I=36 E=2.31745e-26

oxidoreductase

X.species

YP_362575.1 lcl|XCV0844

18

332

S=274 I=32 E=3.71092e-26

putative quinone oxidoreductase

X.species

YP_362772.1 lcl|XCV1041

29

197

S=271 I=39 E=9.7675e-26

putative oxidoreductase

X.species

NP_641146.1 lcl|XAC0794-XAC0794

18

332

S=271 I=31 E=1.03822e-25

quinone reductase

X.species

NP_636320.1 lcl|XCC0934

29

238

S=262 I=37 E=1.01942e-24

oxidoreductase

X.species

NP_639550.1 lcl|XCC4216

1

197

S=251 I=34 E=2.77612e-23

bifunctional oxidoreductase/alginate lyase

X.species

lcl|XALc_0556

29

273

S=245 I=33 E=1.29912e-22

putative oxidoreductase protein

X.species

NP_644643.1 lcl|XAC4349-XAC4349

1

257

S=187 I=30 E=1.42155e-15

alginate lyase

X.species

NP_640557.1 lcl|adh-XAC0201

97

332

S=175 I=31 E=4.04372e-14

alcohol dehydrogenase

X.species

YP_363901.1 lcl|XCV2170

19

233

S=168 I=29 E=3.27749e-13

putative oxidoreductase

X.species

YP_361916.1 lcl|XCV0185

92

332

S=166 I=31 E=5.02436e-13

putative alcohol dehydrogenase

X.species

NP_643205.1 lcl|XAC2896-XAC2896

29

331

S=154 I=27 E=1.57308e-11

alcohol dehydrogenase

X.species

NP_638078.1 lcl|XCC2730

29

331

S=153 I=28 E=1.88915e-11

alcohol dehydrogenase

X.species

YP_366191.1 lcl|XCV4460

1

331

S=151 I=27 E=3.47794e-11

putative oxidoreductase

X.species

YP_364778.1 lcl|XCV3047

29

198

S=145 I=30 E=1.7604e-10

putative alcohol dehydrogenase

X.species

lcl|XALc_3020

127

332

S=115 I=27 E=7.14745e-07

putative zinc-containing alcohol dehydrogenase superfamily protein

X.species

NP_640643.1 lcl|XAC0287-XAC0287

127

332

S=105 I=26 E=1.32627e-05

quinone oxidoreductase

X.species

NP_638735.1 lcl|XCC3389

79

199

S=101 I=31 E=3.94406e-05

alcohol dehydrogenase C

X.species

NP_641087.1 lcl|XAC0734-XAC0734

79

199

S=98 I=31 E=7.99191e-05

alcohol dehydrogenase C

X.species

YP_362519.1 lcl|XCV0788

79

199

S=98 I=31 E=8.42111e-05

putative alcohol dehydrogenase class III

X.species

NP_635665.1 lcl|XCC0270

127

332

S=98 I=25 E=9.18829e-05

quinone oxidoreductase

X.species

lcl|XALc_1049

114

199

S=98 I=32 E=9.68175e-05

putative zinc-containing alcohol dehydrogenase superfamily protein

X.species

YP_364064.1 lcl|XCV2333

114

235

S=98 I=32 E=9.85205e-05

putative Zn-dependent alcohol dehydrogenase

pubmed

1

333

S=855 I=51 E=7.23969e-95

Predicted zinc-binding oxidoreductase

Pubmed 9434161,10094695

 

prodomImg

pubmed

22

332

S=471 I=38 E=2.62172e-48

Putative oxidoreductase

Pubmed 10627032

 

prodomImg

pubmed

1

332

S=455 I=35 E=2.0504e-46

Reticulon-4-interacting protein 1, mitochondrial ; Mitochondrion Transit peptide

Pubmed 12067236

 

prodomImg

pubmed

2

238

S=356 I=39 E=2.23428e-34

Quinone oxidoreductase

Pubmed 16517758

 

prodomImg

pubmed

2

238

S=353 I=40 E=4.52735e-34

Putative quinone oxidoreductase

Pubmed 16517758

 

prodomImg

sp

1

332

S=472 I=34 E=1.07601e-48

Reticulon-4-interacting protein 1 homolog, mitochondrial ; Mitochondrion Transit peptide

 

prodomImg

sp

1

332

S=455 I=35 E=1.39536e-46

Reticulon-4-interacting protein 1, mitochondrial ; Mitochondrion Transit peptide

 

prodomImg

sp

1

332

S=451 I=34 E=3.67272e-46

Reticulon-4-interacting protein 1, mitochondrial ; Mitochondrion Transit peptide

 

prodomImg

sp

1

332

S=446 I=35 E=1.6311e-45

Reticulon-4-interacting protein 1, mitochondrial ; Alternative splicing Mitochondrion Transit peptide

 

prodomImg

sp

1

237

S=374 I=38 E=8.34528e-37

Quinone oxidoreductase-like protein At1g23740, chloroplastic EC=1.-.-.- ; NAD Plastid Transit peptide

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

107

307

NAD(P)-binding domain

Iprscan [PTHR11695:SF34]

14

332

-

Iprscan IPR002085 [PTHR11695]

14

332

Alcohol dehydrogenase superfamily, zinc-containing

Iprscan IPR013149 [PF00107]

156

239

Alcohol dehydrogenase, zinc-binding

Iprscan IPR013154 [PF08240]

27

89

Alcohol dehydrogenase GroES-like

Iprscan IPR020843 [SM00829]

10

330

Polyketide synthase, enoylreductase

PDA6N3Y9

50

98

S=216 I=82 E=1.21718e-18

PD024840

124

333

S=215 I=31 E=1.41164e-18

PD748833

217

279

S=157 I=60 E=1.62763e-11

PDA0J8H3

1

125

S=155 I=31 E=2.56126e-11

PDA1U3L7

99

127

S=130 I=90 E=3.52749e-08

PDA3X2E2

125

182

S=128 I=41 E=4.9561e-08

PDA307C9

90

144

S=126 I=49 E=8.21783e-08

PD709193

129

243

S=123 I=30 E=1.89785e-07

PDA3I1L6

80

146

S=121 I=39 E=3.49395e-07

PDA2E350

24

103

S=118 I=31 E=9.27696e-07

Iprscan IPR011032 [SSF50129]

1

150

GroES-like

Iprscan IPR016040 [SSF51735]

121

260

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 05z4jCqu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

148 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

6 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr24890.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr24890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr24890.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZVX8pi/XFF4834R_chr24890.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.