Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr21730eddXFF4834R_chr21730probable 6-phosphogluconate dehydratase

edd XFF4834R_chr21730
XFF4834R_chr21720
XFF4834R_chr21720
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21740
XFF4834R_chr21740
ID edd
AC XFF4834R_chr21730
LT XFF4834R_chr21730
OR XFF4834R_chr from 2519354 to 2521270 on strand -
DE probable 6-phosphogluconate dehydratase
IP Dihydroxy-acid/6-phosphogluconate dehydratase; 6-phosphogluconate dehydratase
CL 1.3.9 Entner-Doudoroff pathway GO:0009255
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: Entner-Doudoroff pathway (GO:0009255)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: phosphogluconate dehydratase activity (GO:0004456)

Curated
PM
AN
CC COG: [EG] Amino acid transport and metabolism;Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110304)
MW 67426.8 Da
SQ 638 aa
 
........10........20........30........40........50
| | | | |
MSLHPNIQAVTDRIRKRSAPSRAAYLAGLDAALREGPFRSRLSCGNLAHG
FAASEPGDKSRLRGAATPNLGIITAYNDMLSAHQPFEHYPQLIRETARTL
GATAQVAGGVPAMCDGVTQGRAGMELSLFSRDNIAQATAIGLSHDMFDSV
VYLGVCDKIVPGLLIGALAFGHLPAIFMPAGPMTPGIPNKQKAEVRERYA
AGEATRAELLEAEASSYHSPGTCTFYGTANSNQVLLEAMGVQLPGASFVN
PELPLRDALTREGTARALAISALGEDFRPFGRLIDERAIVNAVVALMATG
GSTNHTIHWIAVARAAGIVLTWDDMDLISQTVPLLTRIYPNGEADVNRFQ
AAGGTAFVFRELMDAGYMHDDLPTVVEGGMRAYINEPRLQDGKVTYVPGT
ATTADDSVARPVGDAFESQGGLRLLRGNLGRSLIKLSAVKPQHRSIQAPA
VVIDTPQVLNKLHAAGVLPHDFVVVLRYQGPRANGMPELHSMAPLLGLLQ
NQGRRVALVTDGRLSGASGKFPAAIHLTPEAARGGPIGRVREGDIVRLDG
EAGTLEVLVSAEEWASREVAPNTSIAGNDLGRNLFAINRQVVGPADQGAI
SISCGPTHPDGALWSYDAEYELGADAAAAAAPHESKDA
XFF4834R

XFF4834R_chr03280 lcl|ilvD-XFF4834R_chr03280

68

567

S=345 I=28 E=5.70853e-35

dihydroxyacid dehydratase

XFF4834R

XFF4834R_chr03280 lcl|ilvD-XFF4834R_chr03280

68

567

S=345 I=28 E=5.70853e-35

dihydroxyacid dehydratase

pubmed

1

598

S=1730 I=57 E=0

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

Pubmed 10400573

 

prodomImg

pubmed

1

599

S=1702 I=55 E=0

MocB ; Plasmid

Pubmed 8655509

 

prodomImg

pubmed

3

603

S=1686 I=53 E=0

6-phosphogluconate dehydratase

Pubmed 17209815

 

prodomImg

pubmed

1

599

S=1671 I=55 E=0

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

Pubmed 11983902

 

prodomImg

pubmed

3

603

S=1668 I=53 E=0

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

Pubmed 8045900

 

prodomImg

pubmed

3

599

S=1654 I=55 E=0

6-phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

Pubmed 15101992

 

prodomImg

pubmed

3

603

S=1593 I=50 E=0

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

Pubmed 1624451,8344525

 

prodomImg

pubmed

3

605

S=1560 I=50 E=4.96143e-180

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

Pubmed 2254282

 

prodomImg

pubmed

117

342

S=731 I=61 E=1.43012e-79

6-phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

Pubmed 15870314

 

prodomImg

pubmed

79

246

S=619 I=69 E=5.65862e-66

Phosphogluconate dehydratase

Pubmed 16855247,17921275

 

prodomImg

sp_Pdown

sp|Q9Z3S0|EDD_RHIME

1

598

S=1730 I=57 E=0

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

sp_Pdown

sp|P31961|EDD_PSEAE

3

603

S=1668 I=53 E=0

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

sp_Pdown

sp|P0ADF6|EDD_ECOLI

3

603

S=1593 I=50 E=0

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

sp_Pdown

sp|P0ADF7|EDD_ECO57

3

603

S=1593 I=50 E=0

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

sp_Pdown

sp|P21909|EDD_ZYMMO

3

605

S=1560 I=50 E=3.4155e-180

Phosphogluconate dehydratase EC=4.2.1.12 ; Lyase

Iprscan IPR000581 [PTHR21000]

68

621

Dihydroxy-acid/6-phosphogluconate dehydratase

Iprscan IPR000581 [PF00920]

68

599

Dihydroxy-acid/6-phosphogluconate dehydratase

Iprscan IPR004786 [TIGR01196]

4

603

6-phosphogluconate dehydratase

Iprscan [seg]

200

214

-

Iprscan [seg]

420

431

-

Iprscan [seg]

624

631

-

PD014442

3

82

S=268 I=63 E=6.66899e-25

PD905529

219

378

S=249 I=37 E=1.52424e-22

PD267962

600

638

S=165 I=79 E=2.23779e-12

PD585030

93

148

S=164 I=57 E=3.03631e-12

PD002691

509

601

S=140 I=41 E=2.39344e-09

PDA1F6M4

150

186

S=120 I=57 E=7.10575e-07

PD911039

432

508

S=113 I=37 E=3.92433e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vN0Nfbty)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

96 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhbInKM/XFF4834R_chr21730.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhbInKM/XFF4834R_chr21730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhbInKM/XFF4834R_chr21730.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBhbInKM/XFF4834R_chr21730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.