Xanthomonas fuscans subsp. fuscans

8 hits

  1. XFF4834R_chr35440atpCXFF4834R_chr35440F1 sector of membrane-bound ATP synthase, epsilon subunit
  2. XFF4834R_chr35450atpDXFF4834R_chr35450F0F1 ATP synthase beta subunit
  3. XFF4834R_chr35460atpGXFF4834R_chr35460F0F1 ATP synthase gamma subunit
  4. XFF4834R_chr35470atpAXFF4834R_chr35470F0F1 ATP synthase alpha subunit
  5. XFF4834R_chr35480atpHXFF4834R_chr35480F0F1 ATP synthase delta subunit
  6. XFF4834R_chr35490atpFXFF4834R_chr35490F0F1 ATP synthase subunit B
  7. XFF4834R_chr35500atpEXFF4834R_chr35500F0F1 ATP synthase subunit C
  8. XFF4834R_chr35510atpBXFF4834R_chr35510F0F1 ATP synthase subunit A

atpC XFF4834R_chr35440
XFF4834R_chr_3768
XFF4834R_chr_3768
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35450
XFF4834R_chr35450
ID atpC
AC XFF4834R_chr35440
LT XFF4834R_chr35440
OR XFF4834R_chr from 4117193 to 4117615 on strand -
DE F1 sector of membrane-bound ATP synthase, epsilon subunit
IP ATPase, F1 complex, delta/epsilon subunit; ATPase, F1 complex, delta/epsilon subunit, N-terminal; ATPase, F1 complex, delta/epsilon subunit, C-terminal
CL 1.3.8 ATP proton motive force interconversion GO:0015986
EC
GO InterPro
Biological Process: ATP synthesis coupled proton transport (GO:0015986)
catalytic core F(1) (GO:0045261)
rotational mechanism (GO:0046961)
rotational mechanism (GO:0046933)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100503)
MW 15152.3 Da
SQ 140 aa
 
........10........20........30........40........50
| | | | |
MSTIRCDIVSAEKEIFHGEATLVVATGELGELGIAPKHAPLITRLKPGKV
VVTTANGEQLDFAISGGILEVQPQVVTILVDTAVRAQDIDEAAVRKVKEE
AERLLANRGNTVDVAEAQRQLAEATVQLQALERLRRNLKH
XFF4834R

YP_365497.1 lcl|atpC-XCV3766

1

140

S=636 I=91 E=1.62789e-70

F0F1 ATP synthase subunit epsilon

XFF4834R

NP_643955.1 lcl|atpC-XAC3648

1

140

S=636 I=91 E=1.62789e-70

F0F1 ATP synthase subunit epsilon

XFF4834R

NP_635947.1 lcl|atpC-XCC0555

1

140

S=595 I=84 E=1.32654e-65

F0F1 ATP synthase subunit epsilon

XFF4834R

lcl|atpC-XALc_2905

1

140

S=564 I=79 E=8.62447e-62

probable atp synthase epsilon subunit protein

pubmed

1

135

S=286 I=42 E=1.18626e-26

ATP synthase F1 epsilon subunit ; synthesis CF(1) Ion transport

Pubmed 17392208

 

prodomImg

pubmed

1

135

S=281 I=41 E=4.62249e-26

ATP synthase F1 epsilon subunit ; synthesis CF(1) Ion transport

Pubmed 17392208

 

prodomImg

pubmed

1

135

S=281 I=41 E=4.7038e-26

ATP synthase F1 epsilon subunit ; synthesis CF(1) Ion transport

Pubmed 17392208

 

prodomImg

pubmed

1

135

S=277 I=41 E=1.6223e-25

ATP synthase F1 epsilon subunit ; synthesis CF(1) Ion transport

Pubmed 17392208

 

prodomImg

pubmed

3

138

S=263 I=40 E=6.77262e-24

ATP synthase epsilon chain ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

Pubmed 6395859,6285901

 

prodomImg

pubmed

3

135

S=255 I=44 E=6.25627e-23

ATP synthase epsilon chain ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

Pubmed 7958772

 

prodomImg

pubmed

3

135

S=242 I=43 E=2.37295e-21

Epsilon subunit of F1F0-ATP synthase ; synthesis CF(1) Ion transport

Pubmed 16244438

 

prodomImg

pubmed

3

137

S=239 I=36 E=6.69703e-21

ATP synthase epsilon chain ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

Pubmed 2529481

 

prodomImg

pubmed

1

129

S=206 I=39 E=5.65572e-17

ATP synthase subunit epsilon ; synthesis CF(1) Ion transport

Pubmed 14732496

 

prodomImg

pubmed

7

132

S=201 I=36 E=2.44692e-16

ATP synthase epsilon chain ; synthesis Cell membrane CF(1) Hydrogen ion transport

Pubmed 9216881,9516544

 

prodomImg

sp_Pdown

sp|Q3BP16|ATPE_XANC5

1

140

S=636 I=91 E=3.46368e-69

ATP synthase epsilon chain ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

sp_Pdown

sp|Q8PGG8|ATPE_XANAC

1

140

S=636 I=91 E=3.46368e-69

ATP synthase epsilon chain ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

sp_Pdown

sp|Q2P7Q3|ATPE_XANOM

1

140

S=616 I=88 E=8.63766e-67

ATP synthase epsilon chain ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

sp_Pdown

sp|Q5H4Y3|ATPE_XANOR

1

140

S=610 I=87 E=4.85427e-66

ATP synthase epsilon chain ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

sp_Pdown

sp|B2SQA9|ATPE_XANOP

1

140

S=610 I=87 E=4.85427e-66

ATP synthase epsilon chain ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

PD000944

8

90

S=222 I=60 E=1.97332e-19

PD865953

1

81

S=139 I=38 E=1.97405e-09

PD952845

3

84

S=108 I=34 E=1.40034e-05

PD087477

21

84

S=103 I=44 E=5.17856e-05

PD465470

30

83

S=103 I=44 E=5.55265e-05

PD952849

8

89

S=101 I=27 E=8.29239e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one krqltxiw)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

88 hits
swiss-prot

Swiss-Prot ncbi-blastp

563 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35440.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35440.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
atpD XFF4834R_chr35450
XFF4834R_chr35440
XFF4834R_chr35440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35460
XFF4834R_chr35460
ID atpD
AC XFF4834R_chr35450
LT XFF4834R_chr35450
OR XFF4834R_chr from 4117759 to 4119165 on strand -
DE F0F1 ATP synthase beta subunit
IP ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain; ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal; ATPase, F1/A1 complex, alpha/beta subunit, N-terminal; ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain, active site
CL 1.3.8 ATP proton motive force interconversion GO:0015986
EC
GO InterPro
Biological Process: proton transport (GO:0015992)
Biological Process: ATP synthesis coupled proton transport (GO:0015986)
Biological Process: ATP metabolic process (GO:0046034)
Cellular Component: proton-transporting two-sector ATPase complex (GO:0016469)
Molecular Function: nucleotide binding (GO:0000166)
Molecular Function: nucleoside-triphosphatase activity (GO:0017111)
catalytic domain (GO:0033178)
catalytic core F(1) (GO:0045261)
catalyzing transmembrane movement of substances (GO:0016820)
phosphorylative mechanism (GO:0008553)
rotational mechanism (GO:0046961)
rotational mechanism (GO:0046933)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100503)
MW 50896.4 Da
SQ 468 aa
 
........10........20........30........40........50
| | | | |
MSQGKIVQIIGAVVDVEFPRNEVPKVYHALKVDGTEITLEVQQQLGDGVV
RTIALGSTDGLKRNLVATNTERAISVPVGAGTLGRIMDVLGRPIDEAGDV
QASDHWEIHRGAPSYEDQSSSTELLETGIKVIDLMCPFAKGGKVGLFGGA
GVGKTVNMMELINNIAKAHSGLSVFAGVGERTREGNDFYHEMKDSNVLDK
VAMVYGQMNEPPGNRLRVALTGLTMAEYFRDEKDASGKGKDVLLFVDNIY
RYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKSGSITSIQA
VYVPADDLTDPSPATTFAHLDSTVTLSRNIASLGIYPAVDPLDSTSRQMD
PLVIGHEHYDTAQRVQQTLQKYKELKDIIAILGMDELSEEDKQSVSRARK
IERFFSQPFHVAEVFTGSPGKYVSLKDTIRGFKAICDGEYDHLPEQAFYM
VGSIEEAVEKANKMSAKA
XFF4834R

XFF4834R_chr04010 lcl|XFF4834R_chr04110344_0451672_f2_XFF4834R-XFF4834R_chr04010

4

408

S=315 I=27 E=1.55751e-31

XFF4834R

XFF4834R_chr20800 lcl|fliI-XFF4834R_chr20800

30

410

S=268 I=26 E=9.93441e-26

flagellum-specific ATP synthase

XFF4834R

XFF4834R_chr35470 lcl|atpA-XFF4834R_chr35470

50

272

S=198 I=26 E=2.35989e-17

F1 sector of membrane-bound ATP synthase, alpha subunit

XFF4834R

XFF4834R_chr04010 lcl|XFF4834R_chr04110344_0451672_f2_XFF4834R-XFF4834R_chr04010

4

408

S=315 I=27 E=1.55751e-31

XFF4834R

XFF4834R_chr20800 lcl|fliI-XFF4834R_chr20800

30

410

S=268 I=26 E=9.93441e-26

flagellum-specific ATP synthase

XFF4834R

XFF4834R_chr35470 lcl|atpA-XFF4834R_chr35470

50

272

S=198 I=26 E=2.35989e-17

F1 sector of membrane-bound ATP synthase, alpha subunit

XFF4834R

NP_643956.1 lcl|atpD-XAC3649

1

468

S=2319 I=94 E=0

F0F1 ATP synthase subunit beta

XFF4834R

NP_635946.1 lcl|atpD-XCC0554

1

468

S=2282 I=93 E=0

F0F1 ATP synthase subunit beta

XFF4834R

YP_365498.1 lcl|atpD-XCV3767

1

468

S=2278 I=93 E=0

F0F1 ATP synthase subunit beta

XFF4834R

lcl|atpD-XALc_2906

1

468

S=2182 I=88 E=0

probable atp synthase , beta subunit protein

XFF4834R

NP_636610.1 lcl|hrcN-XCC1236

4

408

S=324 I=28 E=4.84948e-32

type III secretion system ATPase

XFF4834R

YP_362163.1 lcl|hrcN-XCV0432

4

408

S=319 I=28 E=2.09811e-31

type III secretion system ATPase

XFF4834R

NP_640767.1 lcl|hrcN-XAC0412

4

408

S=318 I=27 E=3.30161e-31

type III secretion system ATPase

XFF4834R

NP_637288.1 lcl|fliI-XCC1923

30

418

S=271 I=27 E=1.30371e-25

flagellar protein

XFF4834R

YP_363726.1 lcl|fliI-XCV1995

30

410

S=268 I=26 E=3.77689e-25

flagellar biosynthesis/type III secretory pathway ATPase FliI

XFF4834R

NP_642277.1 lcl|fliI-XAC1951

30

410

S=268 I=26 E=3.77689e-25

flagellar protein

XFF4834R

lcl|fliI-XALc_1393

14

381

S=246 I=27 E=1.58921e-22

probable flagellum-specific atp synthase protein

XFF4834R

NP_635944.1 lcl|atpA-XCC0552

50

272

S=198 I=26 E=8.97187e-17

F0F1 ATP synthase subunit alpha

XFF4834R

YP_365500.1 lcl|atpA-XCV3769

50

272

S=198 I=26 E=9.45371e-17

F0F1 ATP synthase subunit alpha

XFF4834R

NP_643958.1 lcl|atpA-XAC3651

50

272

S=198 I=26 E=9.45371e-17

F0F1 ATP synthase subunit alpha

XFF4834R

lcl|atpA-XALc_2908

50

272

S=194 I=26 E=3.12143e-16

probable atp synthase, alpha subunit protein

XFF4834R

lcl|xsaS-XALc_1495

113

376

S=192 I=25 E=5.35941e-16

probable xanthomonas secretion apparatus protein

pubmed

1

465

S=1815 I=75 E=0

ATP synthase subunit beta EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

Pubmed 8085791

 

prodomImg

pubmed

1

451

S=1811 I=77 E=0

ATP synthase beta subunit ; ATP-binding Nucleotide-binding

Pubmed 15388716

 

prodomImg

pubmed

1

464

S=1811 I=75 E=0

ATP synthase subunit beta EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

Pubmed 6395859,6272217

 

prodomImg

pubmed

1

450

S=1785 I=77 E=0

ATP synthase beta subunit ; ATP-binding Nucleotide-binding

Pubmed 15388716

 

prodomImg

pubmed

1

451

S=1782 I=76 E=0

ATP synthase beta subunit ; ATP-binding Nucleotide-binding

Pubmed 15388716

 

prodomImg

pubmed

1

451

S=1779 I=76 E=0

ATP synthase beta subunit ; ATP-binding Nucleotide-binding

Pubmed 15388716

 

prodomImg

pubmed

7

451

S=1776 I=77 E=0

ATP synthase beta subunit ; ATP-binding Nucleotide-binding

Pubmed 15388716

 

prodomImg

pubmed

1

450

S=1774 I=76 E=0

ATP synthase beta subunit ; ATP-binding Nucleotide-binding

Pubmed 15388716

 

prodomImg

pubmed

1

450

S=1769 I=76 E=0

ATP synthase beta subunit ; ATP-binding Nucleotide-binding

Pubmed 15388716

 

prodomImg

pubmed

1

450

S=1767 I=76 E=0

ATP synthase beta subunit

Pubmed 15388716

 

prodomImg

sp_Pdown

sp|Q8PGG7|ATPB_XANAC

1

468

S=2319 I=94 E=0

ATP synthase subunit beta EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

sp_Pdown

sp|Q5H4Y4|ATPB_XANOR

1

468

S=2306 I=93 E=0

ATP synthase subunit beta EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

sp_Pdown

sp|B2SQB0|ATPB_XANOP

1

468

S=2306 I=93 E=0

ATP synthase subunit beta EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

sp_Pdown

sp|Q2P7Q4|ATPB_XANOM

1

468

S=2306 I=93 E=0

ATP synthase subunit beta EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

sp_Pdown

sp|B0RWC2|ATPB_XANCB

1

468

S=2291 I=93 E=0

ATP synthase subunit beta EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

PD587400

355

456

S=418 I=76 E=3.89669e-43

PDA4J3J8

380

468

S=249 I=55 E=1.27638e-22

PD692862

186

229

S=178 I=69 E=5.58194e-14

PDA1L1S3

154

229

S=174 I=47 E=1.49506e-13

PD544470

355

462

S=168 I=33 E=7.83603e-13

PDA1F6K3

268

313

S=154 I=67 E=3.9977e-11

PD536374

1

74

S=147 I=47 E=2.58298e-10

PD690277

154

185

S=139 I=88 E=2.47074e-09

PD856741

314

354

S=122 I=59 E=3.06735e-07

PD000090

234

265

S=115 I=69 E=2.38009e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 62PHdmYp)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35450.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
atpG XFF4834R_chr35460
XFF4834R_chr35450
XFF4834R_chr35450
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35470
XFF4834R_chr35470
ID atpG
AC XFF4834R_chr35460
LT XFF4834R_chr35460
OR XFF4834R_chr from 4119309 to 4120172 on strand -
DE F0F1 ATP synthase gamma subunit
IP ATPase, F1 complex, gamma subunit
CL 1.3.8 ATP proton motive force interconversion GO:0015986
EC
GO InterPro
Biological Process: ATP synthesis coupled proton transport (GO:0015986)
catalytic core F(1) (GO:0045261)
rotational mechanism (GO:0046933)
rotational mechanism (GO:0046961)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: acur
CC STATUS: curated by opruvost (20100503)
MW 31984.7 Da
SQ 287 aa
 
........10........20........30........40........50
| | | | |
MAGGREIKTKIKSVQNTRKVTRALEMVSASKIRKAQERMKTSRPYAQAMK
QVIGHLAQASTDFQHPFLIEREQVKRVGYIVISSDRGLAGGLNNNLFRKM
LGEVRPWQEQGAEIDVVTIGQKASAFFRRIKVNMVGSVTHLGDSPQVEQL
IGVIKVMIDAFIEGKVDRVYLVYNRFVNTMTQKASFDQLLPLPAAEHTVA
HHDWDYLYEPDAASVLEHVMTRYIESLVYQAVLENVASEHAARMVAMKAA
SDNANKMIGTLQLVYNKARQAAITQEISEIVSGAAAV
XFF4834R

NP_643957.1 lcl|atpG-XAC3650

1

287

S=1509 I=99 E=7.43006e-176

F0F1 ATP synthase subunit gamma

XFF4834R

YP_365499.1 lcl|atpG-XCV3768

1

287

S=1505 I=98 E=2.24843e-175

F0F1 ATP synthase subunit gamma

XFF4834R

NP_635945.1 lcl|atpG-XCC0553

1

287

S=1482 I=96 E=1.59631e-172

F0F1 ATP synthase subunit gamma

XFF4834R

lcl|atpG-XALc_2907

1

287

S=1380 I=89 E=2.93499e-160

probable atp synthase, gamma subunit protein

pubmed

1

287

S=939 I=57 E=3.04667e-105

ATP synthase gamma chain ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

Pubmed 6395859,6272217

 

prodomImg

pubmed

1

287

S=901 I=55 E=1.39641e-100

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

Pubmed 2529481

 

prodomImg

pubmed

1

287

S=879 I=54 E=6.08425e-98

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

Pubmed 10873488

 

prodomImg

pubmed

1

287

S=839 I=54 E=3.91804e-93

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

Pubmed 19077236

 

prodomImg

pubmed

1

285

S=825 I=53 E=2.42151e-91

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

Pubmed 7958772

 

prodomImg

pubmed

1

285

S=784 I=52 E=2.19089e-86

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

Pubmed 16244438

 

prodomImg

pubmed

1

287

S=740 I=45 E=4.95152e-81

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

Pubmed 9216881,9516544

 

prodomImg

pubmed

1

287

S=736 I=45 E=1.1841e-80

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

Pubmed 10555290

 

prodomImg

pubmed

1

287

S=614 I=43 E=7.43106e-66

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

Pubmed 14732496

 

prodomImg

pubmed

1

287

S=604 I=40 E=1.27483e-64

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

Pubmed 10555290

 

prodomImg

sp_Pdown

sp|Q8PGG6|ATPG_XANAC

1

287

S=1509 I=99 E=1.90197e-174

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

sp_Pdown

sp|Q3BP14|ATPG_XANC5

1

287

S=1505 I=98 E=5.7556e-174

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

sp_Pdown

sp|Q5H4Y5|ATPG_XANOR

1

287

S=1504 I=99 E=7.41138e-174

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

sp_Pdown

sp|B2SQB1|ATPG_XANOP

1

287

S=1504 I=99 E=7.41138e-174

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

sp_Pdown

sp|Q2P7Q5|ATPG_XANOM

1

287

S=1504 I=99 E=7.41138e-174

ATP synthase gamma chain ; synthesis CF(1) Hydrogen ion transport

PD001150

7

287

S=617 I=45 E=2.52718e-67

PD277418

1

111

S=229 I=38 E=2.81813e-20

PDA1I5S4

210

287

S=148 I=38 E=1.67082e-10

PDA7B026

24

94

S=125 I=42 E=1.3286e-07

PD807668

107

195

S=123 I=30 E=1.86667e-07

PD744338

217

284

S=122 I=37 E=2.62265e-07

PD138613

5

172

S=116 I=24 E=1.48681e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xkReqB9E)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

203 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35460.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35460.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
atpA XFF4834R_chr35470
XFF4834R_chr35460
XFF4834R_chr35460
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35480
XFF4834R_chr35480
ID atpA
AC XFF4834R_chr35470
LT XFF4834R_chr35470
OR XFF4834R_chr from 4120365 to 4121912 on strand -
DE F0F1 ATP synthase alpha subunit
IP ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain; ATPase, F1/V1/A1 complex, alpha/beta subunit, C-terminal; ATPase, F1/V1/A1 complex, alpha/beta subunit, N-terminal; ATPase, F1/V1/A1 complex, alpha/beta subunit, nucleotide-binding domain, active site
CL 1.3.8 ATP proton motive force interconversion GO:0015986
EC
GO InterPro
Biological Process: ATP metabolic process (GO:0046034)
Biological Process: ATP synthesis coupled proton transport (GO:0015986)
Biological Process: proton transport (GO:0015992)
Cellular Component: proton-transporting two-sector ATPase complex (GO:0016469)
catalytic core F(1) (GO:0045261)
catalytic domain (GO:0033178)
catalyzing transmembrane movement of substances (GO:0016820)
rotational mechanism (GO:0046933)
rotational mechanism (GO:0046961)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100503)
MW 55298.4 Da
SQ 515 aa
 
........10........20........30........40........50
| | | | |
MATTLNPSEISDLIKTRIEAVKLSAESRNEGSVTSVSDGIVRIFGLADVM
QGEMIELPNNTFALALNLERDSVGAVVLGDYESLREGDVAKTTGRILEVP
VGPELLGRVVNALGEPIDGKGPLGATQTAPVERVAPGVIWRKSVDQPVQT
GYKSVDAMIPIGRGQRELVIGDRQTGKTALAIDAVINQKGTGIKCVYVAI
GQKASTVANIVRKLEENGALAHTVVVAATASESAAMQYISPYAGCTMGEY
FMDRGEDALIVYDDLSKQAVAYRQISLLLKRPPGREAYPGDVFYLHSRLL
ERAARVSEEYVEKFTNGAVTGKTGSLTALPIIETQAGDVSAFVPTNVISI
TDGQIFLETDLFNAGIRPAVNAGISVSRVGGAAQTKIIKKLSGGIRISLA
QYRELAAFAQFASDLDEATRKQLERGQRVTELMKQKQYAPMSIANQALSI
YAVNEGYLDDVPVNKLLAFEEGLHAHFANTQGELVSKINSTGGWDNDIEA
SFKKGIEEFKTTGTW
XFF4834R

XFF4834R_chr04010 lcl|XFF4834R_chr04110344_0451672_f2_XFF4834R-XFF4834R_chr04010

13

410

S=315 I=28 E=2.11551e-31

XFF4834R

XFF4834R_chr20800 lcl|fliI-XFF4834R_chr20800

99

438

S=268 I=28 E=1.10418e-25

flagellum-specific ATP synthase

XFF4834R

XFF4834R_chr35450 lcl|atpD-XFF4834R_chr35450

73

435

S=226 I=24 E=1.18933e-20

F1 sector of membrane-bound ATP synthase, beta subunit

XFF4834R

XFF4834R_chr04010 lcl|XFF4834R_chr04110344_0451672_f2_XFF4834R-XFF4834R_chr04010

13

410

S=315 I=28 E=2.11551e-31

XFF4834R

XFF4834R_chr20800 lcl|fliI-XFF4834R_chr20800

99

438

S=268 I=28 E=1.10418e-25

flagellum-specific ATP synthase

XFF4834R

XFF4834R_chr35450 lcl|atpD-XFF4834R_chr35450

73

435

S=226 I=24 E=1.18933e-20

F1 sector of membrane-bound ATP synthase, beta subunit

XFF4834R

YP_365500.1 lcl|atpA-XCV3769

1

515

S=2607 I=97 E=0

F0F1 ATP synthase subunit alpha

XFF4834R

NP_643958.1 lcl|atpA-XAC3651

1

515

S=2607 I=97 E=0

F0F1 ATP synthase subunit alpha

XFF4834R

NP_635944.1 lcl|atpA-XCC0552

1

515

S=2592 I=96 E=0

F0F1 ATP synthase subunit alpha

XFF4834R

lcl|atpA-XALc_2908

1

515

S=2438 I=90 E=0

probable atp synthase, alpha subunit protein

XFF4834R

NP_640767.1 lcl|hrcN-XAC0412

94

410

S=322 I=30 E=9.43866e-32

type III secretion system ATPase

XFF4834R

NP_636610.1 lcl|hrcN-XCC1236

94

410

S=320 I=30 E=2.01529e-31

type III secretion system ATPase

XFF4834R

YP_362163.1 lcl|hrcN-XCV0432

13

410

S=320 I=28 E=2.06869e-31

type III secretion system ATPase

XFF4834R

NP_642277.1 lcl|fliI-XAC1951

99

438

S=268 I=28 E=4.17087e-25

flagellar protein

XFF4834R

YP_363726.1 lcl|fliI-XCV1995

99

438

S=268 I=28 E=4.2074e-25

flagellar biosynthesis/type III secretory pathway ATPase FliI

XFF4834R

NP_637288.1 lcl|fliI-XCC1923

99

438

S=267 I=28 E=4.83724e-25

flagellar protein

XFF4834R

lcl|fliI-XALc_1393

99

435

S=266 I=28 E=6.50637e-25

probable flagellum-specific atp synthase protein

XFF4834R

lcl|atpD-XALc_2906

73

435

S=241 I=25 E=6.77927e-22

probable atp synthase , beta subunit protein

XFF4834R

YP_365498.1 lcl|atpD-XCV3767

73

435

S=229 I=24 E=2.14111e-20

F0F1 ATP synthase subunit beta

XFF4834R

NP_635946.1 lcl|atpD-XCC0554

73

435

S=227 I=24 E=3.55023e-20

F0F1 ATP synthase subunit beta

XFF4834R

NP_643956.1 lcl|atpD-XAC3649

73

435

S=226 I=24 E=4.53188e-20

F0F1 ATP synthase subunit beta

XFF4834R

lcl|xsaS-XALc_1495

127

408

S=168 I=22 E=4.42758e-13

probable xanthomonas secretion apparatus protein

pubmed

5

515

S=2011 I=74 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

Pubmed 2529481,2532151

 

prodomImg

pubmed

5

515

S=1972 I=73 E=0

ATP synthase subunit alpha ; synthesis ATP-binding CF(1) Hydrolase Nucleotide-binding

Pubmed 17526788

 

prodomImg

pubmed

5

515

S=1931 I=71 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

Pubmed 6395859,6272228

 

prodomImg

pubmed

1

515

S=1831 I=66 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

Pubmed 17088354

 

prodomImg

pubmed

5

515

S=1828 I=66 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

Pubmed 19077236

 

prodomImg

pubmed

39

476

S=1828 I=79 E=0

ATP synthase subunit alpha ; synthesis ATP-binding CF(1) Hydrolase Nucleotide-binding

Pubmed 17978204

 

prodomImg

pubmed

39

476

S=1825 I=79 E=0

ATP synthase subunit alpha ; synthesis ATP-binding CF(1) Hydrolase Nucleotide-binding

Pubmed 17978204

 

prodomImg

pubmed

39

476

S=1822 I=79 E=0

ATP synthase subunit alpha ; synthesis ATP-binding CF(1) Hydrolase Nucleotide-binding

Pubmed 17978204

 

prodomImg

pubmed

39

476

S=1821 I=78 E=0

ATP synthase subunit alpha ; synthesis ATP-binding CF(1) Hydrolase Nucleotide-binding

Pubmed 17978204

 

prodomImg

pubmed

5

515

S=1821 I=66 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

Pubmed 7958772

 

prodomImg

sp_Pdown

sp|Q3BP13|ATPA_XANC5

1

515

S=2607 I=97 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

sp_Pdown

sp|Q8PGG5|ATPA_XANAC

1

515

S=2607 I=97 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

sp_Pdown

sp|Q5H4Y6|ATPA_XANOR

1

515

S=2601 I=96 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

sp_Pdown

sp|B2SQB2|ATPA_XANOP

1

515

S=2601 I=96 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

sp_Pdown

sp|Q2P7Q6|ATPA_XANOM

1

515

S=2601 I=96 E=0

ATP synthase subunit alpha EC=3.6.3.14 ; synthesis ATP-binding Cell inner membrane CF(1) Hydrogen ion transport Hydrolase Nucleotide-binding

PD000108

324

392

S=314 I=87 E=1.92193e-30

PDA1F6L9

265

305

S=209 I=93 E=1.10728e-17

PDA3Q7C3

477

515

S=205 I=97 E=3.071e-17

PDA1I0K8

392

486

S=181 I=35 E=2.61839e-14

PDA1F6L6

137

173

S=154 I=76 E=4.56335e-11

PDA1K9Q2

1

30

S=142 I=97 E=1.39185e-09

PD695509

174

218

S=138 I=60 E=3.79351e-09

PD484054

97

136

S=122 I=63 E=3.59416e-07

PD969851

97

166

S=116 I=38 E=2.00234e-06

PD881004

236

264

S=113 I=59 E=3.85058e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one e7XulsPW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35470.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35470.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
atpH XFF4834R_chr35480
XFF4834R_chr35470
XFF4834R_chr35470
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35490
XFF4834R_chr35490
ID atpH
AC XFF4834R_chr35480
LT XFF4834R_chr35480
OR XFF4834R_chr from 4121960 to 4122487 on strand -
DE F0F1 ATP synthase delta subunit
IP ATPase, F1 complex, OSCP/delta subunit
CL 1.3.8 ATP proton motive force interconversion GO:0015986
EC
GO InterPro
Biological Process: ATP synthesis coupled proton transport (GO:0015986)
Cellular Component: plasma membrane (GO:0005886)
catalytic core F(1) (GO:0045261)
rotational mechanism (GO:0046933)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: acur
CC STATUS: curated by opruvost (20100503)
MW 18316.7 Da
SQ 175 aa
 
........10........20........30........40........50
| | | | |
MSQALTLARPYGRAAFAIAREGGNFAPWSDALAFSAQVAGDPRVAALLLN
PALRQEQAVTLLAPPQAGEDYLRFLGVLADAQRLSLLPEVAGLYEHLRAE
AEHVVKATVTSAAAMSQTELDTIAAALKKRFGRDVDITTAVDASLIGGAV
IDTGDVVIDGSLKGKLARLQSSLAH
XFF4834R

NP_643959.1 lcl|atpH-XAC3652

1

175

S=874 I=99 E=3.45244e-99

F0F1 ATP synthase subunit delta

XFF4834R

YP_365501.1 lcl|atpH-XCV3770

1

175

S=868 I=99 E=1.95722e-98

F0F1 ATP synthase subunit delta

XFF4834R

NP_635943.1 lcl|atpH-XCC0551

1

175

S=765 I=87 E=5.28124e-86

F0F1 ATP synthase subunit delta

XFF4834R

lcl|atpH-XALc_2909

1

175

S=568 I=72 E=3.68433e-62

probable h+-transporting two-sector atpase, delta (oscp) subunit; protein

pubmed

1

174

S=314 I=41 E=8.18501e-30

ATP synthase subunit delta ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

Pubmed 19074396

 

prodomImg

pubmed

1

169

S=302 I=40 E=2.47481e-28

ATP synthase subunit delta ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

Pubmed 6395859,6272190

 

prodomImg

pubmed

1

173

S=285 I=38 E=2.58077e-26

ATP synthase ; synthesis Ion transport

Pubmed 17526788

 

prodomImg

pubmed

1

173

S=261 I=35 E=2.21968e-23

ATP synthase subunit delta ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

Pubmed 2529481

 

prodomImg

pubmed

6

175

S=220 I=26 E=2.07956e-18

ATP synthase ; synthesis Ion transport

Pubmed 15119438

 

prodomImg

pubmed

6

175

S=218 I=26 E=3.92995e-18

ATP synthase ; synthesis Ion transport

Pubmed 15119438

 

prodomImg

pubmed

6

175

S=217 I=26 E=5.10484e-18

ATP synthase ; synthesis Ion transport

Pubmed 15119438

 

prodomImg

pubmed

6

175

S=216 I=26 E=5.379e-18

ATP synthase ; synthesis Ion transport

Pubmed 15119438

 

prodomImg

pubmed

6

175

S=214 I=26 E=9.98949e-18

ATP synthase ; synthesis Ion transport

Pubmed 15119438

 

prodomImg

pubmed

1

175

S=209 I=26 E=4.55402e-17

ATP synthase ; synthesis Ion transport

Pubmed 15119438

 

prodomImg

sp_Pdown

sp|Q8PCZ8|ATPD_XANCP

1

175

S=765 I=87 E=1.23905e-84

ATP synthase subunit delta ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

sp_Pdown

sp|B0RWC5|ATPD_XANCB

1

175

S=765 I=87 E=1.23905e-84

ATP synthase subunit delta ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

sp_Pdown

sp|Q4UQF1|ATPD_XANC8

1

175

S=765 I=87 E=1.23905e-84

ATP synthase subunit delta ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

sp_Pdown

sp|Q0A4M5|ATPD_ALHEH

1

175

S=398 I=49 E=4.11922e-40

ATP synthase subunit delta ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

sp_Pdown

sp|Q3SF63|ATPD_THIDA

1

169

S=328 I=43 E=1.1548e-31

ATP synthase subunit delta ; synthesis Cell inner membrane CF(1) Hydrogen ion transport

PD001250

97

175

S=183 I=49 E=1.11566e-14

PD286977

1

57

S=141 I=51 E=1.18093e-09

PDA1O2B6

108

175

S=111 I=34 E=6.06737e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5to4MhoU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

73 hits
swiss-prot

Swiss-Prot ncbi-blastp

369 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35480.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35480.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
atpF XFF4834R_chr35490
XFF4834R_chr35480
XFF4834R_chr35480
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35500
XFF4834R_chr35500
ID atpF
AC XFF4834R_chr35490
LT XFF4834R_chr35490
OR XFF4834R_chr from 4122491 to 4122961 on strand -
DE F0F1 ATP synthase subunit B
IP ATPase, F0 complex, subunit B/B', bacterial/chloroplast; ATPase, F0 complex, subunit B, bacterial
CL 1.3.8 ATP proton motive force interconversion GO:0015986
EC
GO InterPro
Biological Process: ATP synthesis coupled proton transport (GO:0015986)
Molecular Function: hydrogen ion transmembrane transporter activity (GO:0015078)
coupling factor F(o) (GO:0045263)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100503)
MW 17097.3 Da
SQ 156 aa
 
........10........20........30........40........50
| | | | |
MDITLTIFAQALAFAGLIWIVATKIWPPLLQAIEERQQKIAEGLAAADRS
QKDLAQAQEKVNEALKDARTKANEIIDQAHARANQIIEAAKLEAIAEANR
QKDLAQTEIDASATRAREELRKQVSVLAVSGAEKLLKREIDANAHKALLD
ELAAEI
Show or not Domain decomposition
 
XFF4834R

YP_365502.1 lcl|atpF-XCV3771

1

156

S=693 I=92 E=2.19947e-77

F0F1 ATP synthase subunit B

XFF4834R

NP_643960.1 lcl|atpF-XAC3653

1

156

S=693 I=92 E=2.19947e-77

F0F1 ATP synthase subunit B

XFF4834R

NP_635942.1 lcl|atpF-XCC0550

1

156

S=668 I=88 E=2.4148e-74

F0F1 ATP synthase subunit B

XFF4834R

lcl|atpF-XALc_2910

1

156

S=621 I=81 E=1.35144e-68

probable atp synthase, subunit b; protein

pubmed

1

156

S=320 I=44 E=1.06299e-30

ATP synthase B chain ; CF(0) Hydrogen ion transport Transmembrane

Pubmed 17526788

 

prodomImg

pubmed

1

156

S=311 I=44 E=1.62819e-29

ATP synthase subunit b ; synthesis Cell inner membrane CF(0) Hydrogen ion transport Transmembrane

Pubmed 2529481

 

prodomImg

pubmed

1

156

S=302 I=42 E=1.61271e-28

ATP synthase subunit b ; synthesis Cell inner membrane CF(0) Hydrogen ion transport Transmembrane

Pubmed 6395859,6272190

 

prodomImg

pubmed

1

156

S=235 I=34 E=2.61035e-20

ATP synthase B chain ; CF(0) Hydrogen ion transport Transmembrane

Pubmed 16244438

 

prodomImg

pubmed

1

156

S=234 I=34 E=2.77463e-20

ATP synthase subunit b ; synthesis Cell inner membrane CF(0) Hydrogen ion transport Transmembrane

Pubmed 19077236

 

prodomImg

pubmed

1

156

S=231 I=33 E=6.93087e-20

ATP synthase subunit b ; synthesis Cell inner membrane CF(0) Hydrogen ion transport Transmembrane

Pubmed 7958772

 

prodomImg

pubmed

1

152

S=209 I=31 E=3.7553e-17

ATP synthase B chain ; CF(0) Hydrogen ion transport Transmembrane

Pubmed 15119438

 

prodomImg

pubmed

1

152

S=207 I=31 E=5.27616e-17

ATP synthase B chain ; CF(0) Hydrogen ion transport Transmembrane

Pubmed 12453247

 

prodomImg

pubmed

1

152

S=206 I=30 E=6.97407e-17

ATP synthase B chain ; CF(0) Hydrogen ion transport Transmembrane

Pubmed 15119438

 

prodomImg

pubmed

1

152

S=206 I=30 E=7.34861e-17

ATP synthase B chain ; CF(0) Hydrogen ion transport Transmembrane

Pubmed 12453247,15119438

 

prodomImg

sp_Pdown

sp|Q3BP11|ATPF_XANC5

1

156

S=693 I=92 E=4.94449e-76

ATP synthase subunit b ; synthesis Cell inner membrane CF(0) Hydrogen ion transport Transmembrane

sp_Pdown

sp|Q8PGG3|ATPF_XANAC

1

156

S=693 I=92 E=4.94449e-76

ATP synthase subunit b ; synthesis Cell inner membrane CF(0) Hydrogen ion transport Transmembrane

sp_Pdown

sp|Q5H4Y8|ATPF_XANOR

1

156

S=685 I=90 E=4.64786e-75

ATP synthase subunit b ; synthesis Cell inner membrane CF(0) Hydrogen ion transport Transmembrane

sp_Pdown

sp|B2SQB4|ATPF_XANOP

1

156

S=685 I=90 E=4.64786e-75

ATP synthase subunit b ; synthesis Cell inner membrane CF(0) Hydrogen ion transport Transmembrane

sp_Pdown

sp|Q2P7Q8|ATPF_XANOM

1

156

S=685 I=90 E=4.64786e-75

ATP synthase subunit b ; synthesis Cell inner membrane CF(0) Hydrogen ion transport Transmembrane

PDA1I7F0

1

38

S=174 I=84 E=1.37062e-13

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VmZ4YeLh)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

56 hits
swiss-prot

Swiss-Prot ncbi-blastp

331 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35490.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35490.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBFGXDe3/XFF4834R_chr35490.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF48