Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr35570aceFXFF4834R_chr35570probable dihydrolipoamide acetyltransferase

aceF XFF4834R_chr35570
XFF4834R_chr35560
XFF4834R_chr35560
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35580
XFF4834R_chr35580
ID aceF
AC XFF4834R_chr35570
LT XFF4834R_chr35570
OR XFF4834R_chr from 4128926 to 4130704 on strand -
DE probable dihydrolipoamide acetyltransferase
IP Biotin/lipoyl attachment; Dihydrolipoamide acetyltransferase pyruvate dehydrogenase complex
CL 1.3.3 Pyruvate dehydrogenase GO:0006086
EC
GO InterPro
Biological Process: glycolysis (GO:0006096)
Biological Process: metabolic process (GO:0008152)
Cellular Component: pyruvate dehydrogenase complex (GO:0045254)
Molecular Function: protein binding (GO:0005515)
Molecular Function: dihydrolipoyllysine-residue acetyltransferase activity (GO:0004742)
Molecular Function: acyltransferase activity (GO:0008415)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100503)
MW 60358.3 Da
SQ 592 aa
 
........10........20........30........40........50
| | | | |
MAEIKEALVPDIGDYSDVPVIEVLVSVGDTVSKDQSLVTLESDKATMEVP
SSVAGVVKEIKVKVGDSLSQGALVALIEVADAGADAAKPAAAAAPAAPAK
AAPAAAPAPAAKAESAAPAASSDGGGLIEARVPDIGDYTDIPVIEVLVAV
GDTVAKDQSLVTLESDKATMEVPSSAAGVVKELKVKVGDTLSQGNVVAII
AAADGGAGAAQSPAKPTTDTAETAGKVEPVAVPAEPDKLAQREIAQVQGA
RSGAGAQAAQGGQPSAGNPSSPPVTFDADSVLPSKVPYASPVVRVFAREL
GVDLNQLKGSEKGGRITREDVQRFVKAALSGGAPAAAGAAPAGGGNGLNL
LAWPKVDFSKFGETETQPLSRIKKISGANLARNWAMIPHVTQFESADITD
LEALRVALNKENEKAGIKLTMLAFLIKASAAALKKFPEFNASLDAAGENL
TLKKYFHIGFAADTPNGLVVPVIRDVDKKGVLQIAQESGELAKKARDGKL
GPADMSGGCFSISSLGGIGGTAFTPIINAPEVAILGVSKSAMQPVWNGKE
FAPKLMLPLSLSYDHRVIDGALAARFTTYLSQVLADMRRVLL
XFF4834R

XFF4834R_chr29810 lcl|sucB-XFF4834R_chr29810

365

592

S=370 I=36 E=4.65213e-38

dihydrolipoyltranssuccinase

XFF4834R

XFF4834R_chr29810 lcl|sucB-XFF4834R_chr29810

3

77

S=122 I=37 E=5.69142e-08

dihydrolipoyltranssuccinase

XFF4834R

XFF4834R_chr29810 lcl|sucB-XFF4834R_chr29810

151

197

S=106 I=43 E=4.77271e-06

dihydrolipoyltranssuccinase

XFF4834R

XFF4834R_chr35550 lcl|lpd-XFF4834R_chr35550

127

197

S=299 I=85 E=2.05231e-29

lipoamide dehydrogenase, E3 component is part of three enzyme complexes

XFF4834R

XFF4834R_chr35550 lcl|lpd-XFF4834R_chr35550

1

78

S=295 I=81 E=6.0502e-29

lipoamide dehydrogenase, E3 component is part of three enzyme complexes

XFF4834R

XFF4834R_chr04350 lcl|XFF4834R_chr04520330_0500847_r1_XFF4834R-XFF4834R_chr04350

425

576

S=195 I=34 E=7.31993e-17

XFF4834R

XFF4834R_chr04350 lcl|XFF4834R_chr04520330_0500847_r1_XFF4834R-XFF4834R_chr04350

1

75

S=118 I=37 E=1.86288e-07

XFF4834R

XFF4834R_chr04350 lcl|XFF4834R_chr04520330_0500847_r1_XFF4834R-XFF4834R_chr04350

131

197

S=110 I=40 E=1.73592e-06

XFF4834R

XFF4834R_chr29810 lcl|sucB-XFF4834R_chr29810

365

592

S=370 I=36 E=4.65213e-38

dihydrolipoyltranssuccinase

XFF4834R

XFF4834R_chr29810 lcl|sucB-XFF4834R_chr29810

3

77

S=122 I=37 E=5.69142e-08

dihydrolipoyltranssuccinase

XFF4834R

NP_643968.1 lcl|phdB-XAC3661

1

592

S=2367 I=81 E=0

dihydrolipoamide acetyltransferase

XFF4834R

YP_365510.1 lcl|XCV3779

126

592

S=2054 I=86 E=0

dihydrolipoamide acetyltransferase

XFF4834R

YP_365510.1 lcl|XCV3779

1

79

S=373 I=99 E=8.47169e-38

dihydrolipoamide acetyltransferase

XFF4834R

YP_365510.1 lcl|XCV3779

6

77

S=305 I=85 E=1.59032e-29

dihydrolipoamide acetyltransferase

XFF4834R

YP_365510.1 lcl|XCV3779

129

197

S=297 I=87 E=1.34641e-28

dihydrolipoamide acetyltransferase

XFF4834R

NP_635934.1 lcl|phdB-XCC0542

126

592

S=1980 I=84 E=0

dihydrolipoamide acetyltransferase

XFF4834R

NP_635934.1 lcl|phdB-XCC0542

1

79

S=374 I=100 E=5.72239e-38

dihydrolipoamide acetyltransferase

XFF4834R

NP_635934.1 lcl|phdB-XCC0542

6

77

S=308 I=89 E=5.39457e-30

dihydrolipoamide acetyltransferase

XFF4834R

NP_635934.1 lcl|phdB-XCC0542

129

197

S=294 I=86 E=3.24799e-28

dihydrolipoamide acetyltransferase

XFF4834R

lcl|aceF-XALc_2915

270

592

S=1335 I=81 E=2.13856e-154

probable dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex protein

pubmed

285

592

S=1082 I=67 E=3.89261e-122

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

Pubmed 8021225

 

prodomImg

pubmed

1

78

S=226 I=56 E=1.8079e-18

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

Pubmed 8021225

 

prodomImg

pubmed

128

197

S=220 I=61 E=1.23085e-17

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

Pubmed 8021225

 

prodomImg

pubmed

6

78

S=165 I=62 E=4.77227e-11

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

Pubmed 8021225

 

prodomImg

pubmed

126

197

S=165 I=61 E=5.73114e-11

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

Pubmed 8021225

 

prodomImg

pubmed

268

592

S=976 I=57 E=2.78885e-109

Dihydrolipoamide acyltransferase ; Lipoyl

Pubmed 17526788

 

prodomImg

pubmed

6

78

S=222 I=62 E=6.57018e-18

Dihydrolipoamide acyltransferase ; Lipoyl

Pubmed 17526788

 

prodomImg

pubmed

2

79

S=215 I=59 E=3.99378e-17

Dihydrolipoamide acyltransferase ; Lipoyl

Pubmed 17526788

 

prodomImg

pubmed

127

197

S=212 I=62 E=9.55069e-17

Dihydrolipoamide acyltransferase ; Lipoyl

Pubmed 17526788

 

prodomImg

pubmed

129

197

S=209 I=61 E=2.11158e-16

Dihydrolipoamide acyltransferase ; Lipoyl

Pubmed 17526788

 

prodomImg

sp_Pdown

sp|Q59098|ODP2_RALEH

285

592

S=1082 I=67 E=2.68064e-122

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

sp_Pdown

sp|Q59098|ODP2_RALEH

1

78

S=226 I=56 E=1.24501e-18

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

sp_Pdown

sp|Q59098|ODP2_RALEH

128

197

S=220 I=61 E=8.47625e-18

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

sp_Pdown

sp|Q59098|ODP2_RALEH

6

78

S=165 I=62 E=3.28642e-11

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

sp_Pdown

sp|Q59098|ODP2_RALEH

126

197

S=165 I=61 E=3.94675e-11

Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex EC=2.3.1.12 ; Acyltransferase Glycolysis Repeat

PD693419

178

285

S=278 I=66 E=4.28155e-26

PD510157

417

493

S=225 I=56 E=1.08288e-19

PD696372

375

416

S=162 I=71 E=4.65773e-12

PD001115

525

589

S=154 I=52 E=4.01274e-11

PD967011

289

376

S=125 I=36 E=1.24337e-07

PD001730

287

321

S=121 I=66 E=3.79552e-07

PD755452

353

378

S=120 I=85 E=5.81849e-07

PDA6J209

55

79

S=111 I=96 E=7.42113e-06

PD000268

127

177

S=109 I=46 E=1.19875e-05

PD000268

1

54

S=107 I=47 E=2.02264e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zK3v6OO3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

153 hits
swiss-prot

Swiss-Prot ncbi-blastp

146 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBB9VmZI/XFF4834R_chr35570.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBB9VmZI/XFF4834R_chr35570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBB9VmZI/XFF4834R_chr35570.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBB9VmZI/XFF4834R_chr35570.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.