Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr15600XFF4834R_chr16850480_1806535_r3_XFF4834R-XFF4834R_chr15600XFF4834R_chr15600putative endo-beta-N-acetylglucosaminidase

XFF4834R_chr16850480_1806535_r3_XFF4834R-XFF4834R_chr15600 XFF4834R_chr15600
XFF4834R_chr15590
XFF4834R_chr15590
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15610
XFF4834R_chr15610
ID XFF4834R_chr16850480_1806535_r3_XFF4834R-XFF4834R_chr15600
AC XFF4834R_chr15600
LT XFF4834R_chr15600
OR XFF4834R_chr from 1805480 to 1806535 on strand -
DE putative endo-beta-N-acetylglucosaminidase
IP Glycoside hydrolase, family 18, catalytic domain; Glycoside hydrolase, chitinase active site
CL 1.2.4.2 Chitin catabolism GO:0006032
EC
GO InterPro
Biological Process: chitin catabolic process (GO:0006032)
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: chitinase activity (GO:0004568)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 40382.8 Da
SQ 351 aa
 
........10........20........30........40........50
| | | | |
MSKRLTWMLLALALTCAPALAKNPTALFYLMNTQKSTNSFIANVDKIDVV
VPTWYGVDQNGLVNGTPNMYLYDIAKQHKLRVMPILSMTTGREGFHKLMH
DEAAKKRMIESLLIHGKQHKYYGFQFDFENIAWTDRDAYTLMVKQTADAL
HKAGFKMSVAVVPNAPGYAEGGQFSKWMWEYWRGAYDLKALGQAVDLVSL
MTYDQHTRWTTPGPVDGMVWMKKHLDYAITQVPKDKLSLGIATYGYRWYT
GNPVKEDGTEASNISATYIDADESFPLAQEQNATVQWDPVEQESWFYFYR
DDMREWVFRPDARSFKARYELTKQYGLEGFSCWVLGAEDPKVWDELPTAQ
R
XFF4834R

NP_643382.1 lcl|XAC3073-XAC3073

1

351

S=1808 I=95 E=0

hypothetical protein

XFF4834R

YP_364939.1 lcl|XCV3208

1

351

S=1774 I=94 E=0

glycoside hydrolase family 18 protein

XFF4834R

NP_638237.1 lcl|XCC2889

1

351

S=1745 I=92 E=0

hypothetical protein

XFF4834R

lcl|XALc_2218

22

351

S=1613 I=88 E=0

putative glycosyl hydrolases family 18 protein

pubmed

55

343

S=320 I=28 E=4.91936e-30

Spore germination protein yaaH ; Repeat

Pubmed 7584024

 

prodomImg

pubmed

71

346

S=249 I=28 E=1.59945e-21

Cortical-lytic enzyme

Pubmed 10692353

 

prodomImg

pubmed

81

335

S=243 I=29 E=8.38316e-21

Putative sporulation-specific glycosylase ydhD EC=3.2.-.- ; Carbohydrate metabolism Glycosidase Hydrolase Polysaccharide degradation Repeat

Pubmed 9202461

 

prodomImg

pubmed

41

341

S=157 I=24 E=2.38753e-10

Midgut chitinase ; Glycosidase Hydrolase

Pubmed 16313571

 

prodomImg

pubmed

93

336

S=137 I=25 E=5.80024e-08

Chitinase domain-containing protein 1 ; Alternative splicing Lysosome Polymorphism Secreted Signal

Pubmed 16357325

 

prodomImg

pubmed

91

339

S=130 I=23 E=4.66037e-07

Chitinase2

Pubmed 15253874

 

prodomImg

pubmed

91

339

S=119 I=23 E=1.00293e-05

Chitinase1

Pubmed 15253874

 

prodomImg

pubmed

76

339

S=116 I=24 E=2.16015e-05

Venom chitinase ; Glycosidase Hydrolase

Pubmed 8063715

 

prodomImg

pubmed

179

339

S=115 I=28 E=2.75743e-05

Chitinase 7 ; Glycosidase Hydrolase

Pubmed 18342250

 

prodomImg

sp_Pdown

sp|P37531|YAAH_BACSU

55

343

S=320 I=28 E=3.38644e-30

Spore germination protein yaaH ; Repeat

sp_Pdown

sp|O32258|YVBX_BACSU

29

346

S=281 I=26 E=1.44757e-25

Uncharacterized glycosylase yvbX EC=3.2.-.- ; Glycosidase Hydrolase Signal

sp_Pdown

sp|O05495|YDHD_BACSU

81

335

S=243 I=29 E=5.77088e-21

Putative sporulation-specific glycosylase ydhD EC=3.2.-.- ; Carbohydrate metabolism Glycosidase Hydrolase Polysaccharide degradation Repeat

sp_Pdown

sp|O31682|YKVQ_BACSU

40

256

S=160 I=26 E=8.32597e-11

Putative glycosylase ykvQ EC=3.2.-.- ; Carbohydrate metabolism Glycosidase Hydrolase Polysaccharide degradation

sp_Pdown

sp|Q5RFF6|CHID1_PONAB

95

336

S=138 I=25 E=3.78932e-08

Chitinase domain-containing protein 1 ; Lysosome Secreted Signal

Iprscan IPR013781 [G3DSA:3.20.20.80]

13

339

Glycoside hydrolase, subgroup, catalytic core

Iprscan IPR001223 [PF00704]

93

338

Glycoside hydrolase, family 18, catalytic domain

Iprscan IPR011583 [SM00636]

24

338

Chitinase II

Iprscan [seg]

9

21

-

PD603520

22

119

S=341 I=65 E=7.59351e-34

PD467710

120

248

S=240 I=40 E=1.20382e-21

PDA1G0K4

265

346

S=177 I=47 E=5.45601e-14

PDA4S9Z3

249

276

S=129 I=82 E=3.51054e-08

PDA4E404

220

339

S=105 I=28 E=2.74324e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LXCyNfmY)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLi7tEt/XFF4834R_chr15600.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLi7tEt/XFF4834R_chr15600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLi7tEt/XFF4834R_chr15600.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLi7tEt/XFF4834R_chr15600.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.