Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr04200malQXFF4834R_chr04200probable 4-alpha-glucanotransferase
  2. XFF4834R_chr04230glgX1XFF4834R_chr04230probable glycogen debranching enzyme
  3. XFF4834R_chr13830glgX2XFF4834R_chr13830probable glycogen debranching enzyme
  4. XFF4834R_chr26330XFF4834R_chr28790758_3041434_r3_XFF4834R-XFF4834R_chr26330XFF4834R_chr26330putative cyclomaltodextrin glucanotransferase

malQ XFF4834R_chr04200
XFF4834R_chr04190
XFF4834R_chr04190
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04210
XFF4834R_chr04210
ID malQ
AC XFF4834R_chr04200
LT XFF4834R_chr04200
OR XFF4834R_chr from 477838 to 479787 on strand +
DE probable 4-alpha-glucanotransferase
IP Glycoside hydrolase, family 77; Glycoside hydrolase, catalytic core
CL 1.2.4.1 Glycogen catabolism GO:0005980
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: 4-alpha-glucanotransferase activity (GO:0004134)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)

Curated
PM
AN glycogen debranching system with glgX
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 69408.2 Da
SQ 649 aa
 
........10........20........30........40........50
| | | | |
MSARDPGGDDLGTLAAAAGVMVDWVDASDQPRQVCEQSVHAVLSALELPA
ATAAQRADSLRRCQAQAAEAAPLLTVQVGEPLPLRVEAHASGRWTDDSGA
SDDARADAQGHVRAPQRFGYWTLQIGAITQQVAVAPPRCFSVADACGQPS
PRAWGMALQVYSARSLDDGGIGDAAGTVEWLRHAALAGADALALSPVHAS
RPVTGGYSPYSPSDRRFLDPLHAAPVRILGELALDAINAVPGLRERFDGL
HNAALIDWQASAHAKWELLRQLYTRVSPDHADLVAFRNAGGAALQGFARF
AAQDFGDNDPQLHVFTQWLAARSWSDAQREAHERGMKIGLIADLAVGFDP
NGAEAAAAADTVLRGLVLGAPPDAFNADGQHWGIGAYSPTALRRSGYAPY
IALLRAVLRDRGGIRIDHILGLMRLWVVPDGASSNEGAYLAYPLHDLLNL
LALESWRHRAIVIGEDLGVVPPGIREELSQRGVMGIDVLMFTRNDDGAFV
SPALWRPDAIATTTTHDLPTLTGWRTGCDIEWRRKLELIQPAQASDDAAA
RDKDVARLDAAVEHAGLSSTRDPLLGALRFTATSVSPLALLPVEDALALD
EQPNLPGTVEVHPNWRRRLPDPLPHARLSSALQGFAEARRVAAVSEPHP
XFF4834R

NP_640783.1 lcl|malQ-XAC0428

1

649

S=2759 I=86 E=0

4-alpha-glucanotransferase

XFF4834R

YP_362185.1 lcl|malQ-XCV0454

1

649

S=2739 I=85 E=0

4-alpha-glucanotransferase

XFF4834R

NP_635805.1 lcl|malQ-XCC0411

20

649

S=2345 I=75 E=0

4-alpha-glucanotransferase

XFF4834R

lcl|XALc_2593

20

645

S=1419 I=52 E=1.81346e-164

probable 4-alpha-glucanotransferase protein

pubmed

140

616

S=495 I=34 E=6.95192e-51

Putative acarbose 4-alpha-glucanotransferase GacQ

Pubmed 19059289

 

prodomImg

pubmed

308

619

S=399 I=33 E=2.90328e-39

4-alpha-glucanotransferase EC=2.4.1.25 ; Carbohydrate metabolism Cytoplasm Glycosyltransferase

Pubmed 2845225

 

prodomImg

pubmed

48

222

S=127 I=26 E=2.65714e-06

4-alpha-glucanotransferase EC=2.4.1.25 ; Carbohydrate metabolism Cytoplasm Glycosyltransferase

Pubmed 2845225

 

prodomImg

pubmed

312

647

S=390 I=33 E=3.51422e-38

Putative acarbose 4-alpha-glucanotransferase AcbQ

Pubmed 10196166,11443082

 

prodomImg

pubmed

312

495

S=186 I=30 E=1.58403e-13

4-alpha-glucanotransferase EC=2.4.1.25 ; Carbohydrate metabolism Cytoplasm Glycosyltransferase

Pubmed 10677288

 

prodomImg

sp_Pdown

sp|P65336|MALQ_MYCTU

152

646

S=458 I=30 E=1.25254e-46

4-alpha-glucanotransferase EC=2.4.1.25 ; Carbohydrate metabolism Cytoplasm Glycosyltransferase

sp_Pdown

sp|P65337|MALQ_MYCBO

152

646

S=458 I=30 E=1.25254e-46

4-alpha-glucanotransferase EC=2.4.1.25 ; Carbohydrate metabolism Cytoplasm Glycosyltransferase

sp_Pdown

sp|P15977|MALQ_ECOLI

308

619

S=399 I=33 E=1.97669e-39

4-alpha-glucanotransferase EC=2.4.1.25 ; Carbohydrate metabolism Cytoplasm Glycosyltransferase

sp_Pdown

sp|P15977|MALQ_ECOLI

48

222

S=127 I=26 E=1.80911e-06

4-alpha-glucanotransferase EC=2.4.1.25 ; Carbohydrate metabolism Cytoplasm Glycosyltransferase

sp_Pdown

sp|P45176|MALQ_HAEIN

311

499

S=358 I=38 E=1.75752e-34

4-alpha-glucanotransferase EC=2.4.1.25 ; Carbohydrate metabolism Cytoplasm Glycosyltransferase

Iprscan IPR013781 [G3DSA:3.20.20.80]

148

642

Glycoside hydrolase, subgroup, catalytic core

Iprscan IPR003385 [PF02446]

158

301

Glycoside hydrolase, family 77

Iprscan IPR003385 [PF02446]

311

625

Glycoside hydrolase, family 77

Iprscan IPR003385 [TIGR00217]

113

641

Glycoside hydrolase, family 77

Iprscan [seg]

7

19

-

Iprscan [seg]

96

108

-

Iprscan [seg]

184

194

-

Iprscan [seg]

353

359

-

Iprscan [seg]

512

522

-

Iprscan [seg]

542

561

-

PD005929

299

530

S=440 I=41 E=9.80979e-46

PD719637

274

311

S=172 I=87 E=2.96688e-13

PD452797

311

352

S=159 I=71 E=1.04038e-11

PDA1W200

621

649

S=141 I=97 E=1.99736e-09

PD398301

22

90

S=130 I=48 E=4.11503e-08

PD186621

138

277

S=122 I=36 E=4.07591e-07

PD043067

572

620

S=111 I=51 E=6.81186e-06

Iprscan IPR017853 [SSF51445]

151

627

Glycoside hydrolase, catalytic core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one cRySVNs4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

16 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr04200.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr04200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr04200.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr04200.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
glgX1 XFF4834R_chr04230
XFF4834R_chr04220
XFF4834R_chr04220
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04240
XFF4834R_chr04240
ID glgX1
AC XFF4834R_chr04230
LT XFF4834R_chr04230
OR XFF4834R_chr from 482721 to 484883 on strand +
DE probable glycogen debranching enzyme
IP Glycosyl hydrolase, family 13, subfamily, catalytic domain; Glycogen debranching enzyme GlgX; Glycoside hydrolase, catalytic core
CL 1.2.4.1 Glycogen catabolism GO:0005980
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Biological Process: glycogen catabolic process (GO:0005980)
Molecular Function: glycogen debranching enzyme activity (GO:0004133)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN glycogen debranching system with malQ
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 80879.1 Da
SQ 720 aa
 
........10........20........30........40........50
| | | | |
MATRKFTQRSRIREGRPNPLGATWDGLGVNFALYSRNATRVELCLFDDRG
REQERIALPEYTDEVWHGYLPDARPGQLYGYRVHGPYAPDAGHRFNHNKL
LLDPYAKQIVGELKWAPHLFGYTIGHRDKDLSFDRRDSAAFMPKSAVIDP
AFTWGQDRPPQTPWNRTVIYEAHVRGLSMLHPAVPPEERGTFSALKTDEL
IDHISSLGVTAVELLPVHAFVDDQYLLEKGLRNYWGYNTLGFFAPQARYM
STRTVAEFKQMVARLHHAGLEVLLDVVYNHTAEGNELGPTLSFKGIDNAS
YYRLADDRRFYINDTGTGNTFDLTNVGALRMVMDSLRYWVQEMHVDGFRF
DLASILGRERYGFDPSGSFLDAVRQDPVLSQTKLIAEPWDIGPGGYQVGN
FPPGWVEWNDKFRDNVRAFWRGDGGQLAELATRLTGSADLFDHSGRRPTA
SVNFVTAHDGFTLRDLVSYEGKHNLANGEDGRDGSDHNISSNYGVEGETN
DPAIKQLRRQQMRNLLATLLLSQGTPMLLAGDEFGHSQNGNNNAYCQDNE
LTWIDWTAATKAAAADQAAFVRRLIRIRQRYPLLHRARFFDGKFDEALGL
KDLTWLAPNGTEMDEAGWHDPEARALMLRLDGRSPTTGLREIAANVTLLM
LINAASTAVSFTLPAMHDEHWRVLVDTARHGGRVVAGGSEWKAPAHSLTL
LAVERDRIVSSARIVSEGAR
XFF4834R

XFF4834R_chr13830 lcl|glgX-XFF4834R_chr13830

2

707

S=2383 I=62 E=0

glycogen debranching enzyme

XFF4834R

XFF4834R_chr04180 lcl|glgB-XFF4834R_chr04180

197

362

S=151 I=31 E=2.124e-11

1,4-alpha-glucan branching enzyme

XFF4834R

XFF4834R_chr04190 lcl|XFF4834R_chr04330084_0477841_f2_XFF4834R-XFF4834R_chr04190

163

351

S=144 I=29 E=1.34863e-10

XFF4834R

XFF4834R_chr00960 lcl|glgB-XFF4834R_chr00960

197

359

S=135 I=30 E=1.97759e-09

1,4-alpha-glucan branching enzyme

XFF4834R

NP_640786.1 lcl|glgX-XAC0431

1

720

S=3762 I=98 E=0

glycogen debranching enzyme

XFF4834R

YP_362188.1 lcl|glgX1-XCV0457

1

720

S=3725 I=98 E=0

glycogen debranching enzyme

XFF4834R

NP_635808.1 lcl|glgX-XCC0414

1

720

S=3688 I=96 E=0

glycogen debranching enzyme

XFF4834R

lcl|glgX-XALc_2596

1

712

S=2933 I=76 E=0

probable glycogen debranching enzyme protein

XFF4834R

NP_643562.1 lcl|glgX-XAC3254

2

707

S=2389 I=62 E=0

glycogen debranching enzyme

XFF4834R

YP_365099.1 lcl|glgX2-XCV3368

2

707

S=2380 I=62 E=0

glycogen debranching enzyme

XFF4834R

NP_638456.1 lcl|glgX-XCC3109

2

704

S=2354 I=62 E=0

glycogen debranching enzyme

XFF4834R

YP_362183.1 lcl|glgB2-XCV0452

197

362

S=151 I=31 E=7.46112e-11

glycogen branching enzyme

XFF4834R

NP_635804.1 lcl|XCC0410

163

351

S=151 I=29 E=8.07016e-11

maltooligosyltrehalose trehalohydrolase

XFF4834R

NP_640781.2 lcl|glgB2-XAC0426

197

362

S=151 I=31 E=8.28403e-11

glycogen branching enzyme

XFF4834R

lcl|glgB-XALc_2592

163

351

S=150 I=31 E=1.08548e-10

putative 1,4-alpha-glucan branching enzyme protein

XFF4834R

NP_640782.1 lcl|XAC0427-XAC0427

152

351

S=145 I=28 E=3.84297e-10

maltooligosyltrehalose trehalohydrolase

XFF4834R

NP_635803.1 lcl|glgB2-XCC0409

199

362

S=144 I=31 E=5.03557e-10

glycogen branching enzyme

XFF4834R

YP_362184.1 lcl|XCV0453

163

351

S=140 I=29 E=1.79837e-09

alpha-amylase family protein

XFF4834R

NP_635530.2 lcl|glgB1-XCC0135

197

359

S=138 I=31 E=3.22533e-09

glycogen branching enzyme

XFF4834R

YP_361872.1 lcl|glgB1-XCV0141

197

359

S=135 I=30 E=7.44866e-09

glycogen branching enzyme

XFF4834R

NP_640512.2 lcl|glgB1-XAC0156

197

359

S=134 I=30 E=8.12725e-09

glycogen branching enzyme

XFF4834R

lcl|glgB-XALc_2649

200

359

S=125 I=28 E=1.14092e-07

probable 1,4-alpha-glucan branching enzyme protein

pubmed

11

701

S=1914 I=54 E=0

Glycogen debranching enzyme ; Glycosidase Hydrolase

Pubmed 10669803

 

prodomImg

pubmed

11

701

S=1812 I=52 E=0

TreX ; Glycosidase Hydrolase

Pubmed 18663442

 

prodomImg

pubmed

10

718

S=1796 I=54 E=0

Putative glycogen debranching enzyme ; Glycosidase Hydrolase

Pubmed 8596463,10821190

 

prodomImg

pubmed

12

664

S=1772 I=51 E=0

Amylase Glycogen debranching enzyme

Pubmed 8980629

 

prodomImg

pubmed

6

664

S=1719 I=49 E=0

Glycogen debranching enzyme (TreX) EC=3.2.1.- Glycogen operon protein GlgX ; Glycosidase Hydrolase

Pubmed 8899719

 

prodomImg

sp_Pdown

sp|P0A4Y4|GLGX_MYCTU

15

701

S=1819 I=52 E=0

Glycogen operon protein glgX homolog EC=3.2.1.- ; Glycosidase Hydrolase

sp_Pdown

sp|P0A4Y5|GLGX_MYCBO

15

701

S=1819 I=52 E=0

Glycogen operon protein glgX homolog EC=3.2.1.- ; Glycosidase Hydrolase

sp_Pdown

sp|A8GKU9|GLGX_SERP5

10

705

S=1559 I=49 E=6.78512e-180

Glycogen debranching enzyme EC=3.2.1.- ; Carbohydrate metabolism Glycosidase Hydrolase

sp_Pdown

sp|B4SVN4|GLGX_SALNS

10

701

S=1504 I=48 E=2.63073e-173

Glycogen debranching enzyme EC=3.2.1.- ; Carbohydrate metabolism Glycosidase Hydrolase

sp_Pdown

sp|A9MTV3|GLGX_SALPB

10

701

S=1504 I=47 E=2.70045e-173

Glycogen debranching enzyme EC=3.2.1.- ; Carbohydrate metabolism Glycosidase Hydrolase

Iprscan IPR013783 [G3DSA:2.60.40.10]

14

149

Immunoglobulin-like fold

Iprscan IPR013781 [G3DSA:3.20.20.80]

151

588

Glycoside hydrolase, subgroup, catalytic core

Iprscan [PTHR10357:SF25]

150

701

-

Iprscan [PTHR10357]

150

701

-

Iprscan IPR004193 [PF02922]

19

106

Glycoside hydrolase, family 13, N-terminal

Iprscan IPR006047 [PF00128]

201

538

Glycosyl hydrolase, family 13, catalytic domain

Iprscan IPR006589 [SM00642]

190

578

Glycosyl hydrolase, family 13, subfamily, catalytic domain

Iprscan IPR011837 [TIGR02100]

14

703

Glycogen debranching enzyme GlgX

Iprscan [seg]

558

569

-

PD008556

412

538

S=416 I=67 E=9.33149e-43

PDA1G1A6

483

538

S=212 I=75 E=4.47086e-18

PD472585

540

610

S=208 I=52 E=1.36478e-17

PDA1F7Q5

364

413

S=207 I=75 E=1.85179e-17

PD861360

92

148

S=187 I=66 E=5.69279e-15

PD203330

5

52

S=181 I=71 E=2.55037e-14

PDA1F8I8

55

90

S=152 I=78 E=9.24525e-11

PDA7H809

226

283

S=145 I=52 E=6.51772e-10

PDA1F7Y5

288

320

S=138 I=79 E=4.88403e-09

PD418582

612

705

S=131 I=36 E=3.38363e-08

Iprscan IPR017853 [SSF51445]

151

589

Glycoside hydrolase, catalytic core

Iprscan IPR014756 [SSF81296]

14

170

Immunoglobulin E-set

Iprscan [SSF51011]

598

704

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one iJjU8dNv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

159 hits
swiss-prot

Swiss-Prot ncbi-blastp

341 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr04230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr04230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr04230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr04230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
glgX2 XFF4834R_chr13830
XFF4834R_chr13820
XFF4834R_chr13820
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13840
XFF4834R_chr13840
ID glgX2
AC XFF4834R_chr13830
LT XFF4834R_chr13830
OR XFF4834R_chr from 1581677 to 1583809 on strand -
DE probable glycogen debranching enzyme
IP Glycosyl hydrolase, family 13, subfamily, catalytic domain; Glycogen debranching enzyme GlgX; Glycoside hydrolase, catalytic core
CL 1.2.4.1 Glycogen catabolism GO:0005980
EC
GO InterPro
Biological Process: glycogen catabolic process (GO:0005980)
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: glycogen debranching enzyme activity (GO:0004133)
Molecular Function: cation binding (GO:0043169)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 80275.5 Da
SQ 710 aa
 
........10........20........30........40........50
| | | | |
MRRPASAAYANPSRIRQGRPFPRGAVFDGKGTNFALFSAHATRVELCLFD
EQGNETRVDLPEYTNEIWHGYLPDAKPGQRYGYRVHGPYAPTEGHRFNHN
KLLLDPYARELEGDLIWADELYGYTVGHPDGDLSFDERDSAPFMPKCVVV
EDTYDWGDDTRLLKPWNETVIYETHVRGYTMRNRQVPEAVRGTFAGLAQP
QVLQYIKDLGITAVELLPVHAYLDDQHLLDKGLRNYWGYNTIGFFALKSR
YLSSGHRDEFRDMVKAMHKQGLEVILDVVYNHTAEGSELGPTLSFKGIDN
ASYYRLADDKRYYINDTGTGNTLNLSNSRVIQFVNDSLRYWAGEMHVDGF
RFDLATILGREPSGFDQRGGFLDACNQDPLLSEVKLIAEPWDCGPGGYQV
GHFPPGWSEWNDKFRDNAREFWKGEDGKLAEFATRFTGSADLFDRRGRRP
WASVNFITAHDGFTLRDLVSYNEKHNIDNGEDNRDGSSNDGSCNYGEEGD
TDNAEVLQIRERQMKNLLATLLLSQGTPMMLSGDERAQTQGGNNNTYCQD
NEITWLDWENDPTDGRLTEFVKALTRLRKRYPILSRGRFLNGQYNEEAGL
RDLTWLNPGGIEMDDAHWTDPAARSVGLLLEGKAQTSGVKELANDDTLLI
VINAYHEGVAFTLPSSDEPVHWKLVLSTDEALEVDMMPAGASEFLAPPRS
VSVFECKSDQ
XFF4834R

XFF4834R_chr04230 lcl|XFF4834R_chr04370721_0484883_f3_XFF4834R-XFF4834R_chr04230

5

710

S=2383 I=62 E=0

XFF4834R

XFF4834R_chr04190 lcl|XFF4834R_chr04330084_0477841_f2_XFF4834R-XFF4834R_chr04190

118

437

S=184 I=29 E=1.9062e-15

XFF4834R

XFF4834R_chr04180 lcl|glgB-XFF4834R_chr04180

171

361

S=144 I=28 E=1.56694e-10

1,4-alpha-glucan branching enzyme

XFF4834R

XFF4834R_chr00960 lcl|glgB-XFF4834R_chr00960

141

363

S=129 I=29 E=1.0028e-08

1,4-alpha-glucan branching enzyme

XFF4834R

NP_643562.1 lcl|glgX-XAC3254

1

710

S=3793 I=99 E=0

glycogen debranching enzyme

XFF4834R

YP_365099.1 lcl|glgX2-XCV3368

1

710

S=3781 I=99 E=0

glycogen debranching enzyme

XFF4834R

NP_638456.1 lcl|glgX-XCC3109

1

707

S=3646 I=95 E=0

glycogen debranching enzyme

XFF4834R

NP_635808.1 lcl|glgX-XCC0414

5

710

S=2389 I=62 E=0

glycogen debranching enzyme

XFF4834R

NP_640786.1 lcl|glgX-XAC0431

5

710

S=2387 I=62 E=0

glycogen debranching enzyme

XFF4834R

YP_362188.1 lcl|glgX1-XCV0457

5

710

S=2384 I=62 E=0

glycogen debranching enzyme

XFF4834R

lcl|glgX-XALc_2596

13

710

S=2380 I=62 E=0

probable glycogen debranching enzyme protein

XFF4834R

NP_640782.1 lcl|XAC0427-XAC0427

118

437

S=185 I=29 E=5.82315e-15

maltooligosyltrehalose trehalohydrolase

XFF4834R

lcl|glgB-XALc_2592

146

365

S=180 I=31 E=2.56368e-14

putative 1,4-alpha-glucan branching enzyme protein

XFF4834R

NP_635804.1 lcl|XCC0410

152

353

S=172 I=31 E=2.5393e-13

maltooligosyltrehalose trehalohydrolase

XFF4834R

YP_362184.1 lcl|XCV0453

145

437

S=171 I=28 E=2.72274e-13

alpha-amylase family protein

XFF4834R

NP_635803.1 lcl|glgB2-XCC0409

201

361

S=145 I=28 E=3.78273e-10

glycogen branching enzyme

XFF4834R

YP_362183.1 lcl|glgB2-XCV0452

201

361

S=144 I=29 E=5.90089e-10

glycogen branching enzyme

XFF4834R

NP_640781.2 lcl|glgB2-XAC0426

171

361

S=144 I=28 E=5.95256e-10

glycogen branching enzyme

XFF4834R

NP_635530.2 lcl|glgB1-XCC0135

141

363

S=131 I=28 E=2.01582e-08

glycogen branching enzyme

XFF4834R

NP_640512.2 lcl|glgB1-XAC0156

141

363

S=129 I=29 E=3.61533e-08

glycogen branching enzyme

XFF4834R

YP_361872.1 lcl|glgB1-XCV0141

196

363

S=129 I=30 E=4.08469e-08

glycogen branching enzyme

XFF4834R

lcl|glgB-XALc_2649

196

363

S=107 I=26 E=1.67435e-05

probable 1,4-alpha-glucan branching enzyme protein

pubmed

15

708

S=1898 I=53 E=0

Glycogen debranching enzyme ; Glycosidase Hydrolase

Pubmed 10669803

 

prodomImg

pubmed

14

705

S=1829 I=51 E=0

TreX ; Glycosidase Hydrolase

Pubmed 18663442

 

prodomImg

pubmed

13

678

S=1755 I=53 E=0

Putative glycogen debranching enzyme ; Glycosidase Hydrolase

Pubmed 8596463,10821190

 

prodomImg

pubmed

15

676

S=1729 I=49 E=0

Amylase Glycogen debranching enzyme

Pubmed 8980629

 

prodomImg

pubmed

15

678

S=1697 I=49 E=0

Glycogen debranching enzyme (TreX) EC=3.2.1.- Glycogen operon protein GlgX ; Glycosidase Hydrolase

Pubmed 8899719

 

prodomImg

sp_Pdown

sp|P0A4Y4|GLGX_MYCTU

18

704

S=1790 I=50 E=0

Glycogen operon protein glgX homolog EC=3.2.1.- ; Glycosidase Hydrolase

sp_Pdown

sp|P0A4Y5|GLGX_MYCBO

18

704

S=1790 I=50 E=0

Glycogen operon protein glgX homolog EC=3.2.1.- ; Glycosidase Hydrolase

sp_Pdown

sp|A8GKU9|GLGX_SERP5

13

689

S=1603 I=50 E=0

Glycogen debranching enzyme EC=3.2.1.- ; Carbohydrate metabolism Glycosidase Hydrolase

sp_Pdown

sp|A6TF50|GLGX_KLEP7

13

623

S=1600 I=53 E=0

Glycogen debranching enzyme EC=3.2.1.- ; Carbohydrate metabolism Glycosidase Hydrolase

sp_Pdown

sp|B6I2Z7|GLGX_ECOSE

13

667

S=1595 I=50 E=0

Glycogen debranching enzyme EC=3.2.1.- ; Carbohydrate metabolism Glycosidase Hydrolase

Iprscan IPR013783 [G3DSA:2.60.40.10]

17

151

Immunoglobulin-like fold

Iprscan IPR013781 [G3DSA:3.20.20.80]

153

588

Glycoside hydrolase, subgroup, catalytic core

Iprscan [PTHR10357:SF25]

145

704

-

Iprscan [PTHR10357]

145

704

-

Iprscan IPR006047 [PF00128]

202

540

Glycosyl hydrolase, family 13, catalytic domain

Iprscan IPR004193 [PF02922]

24

108

Glycoside hydrolase, family 13, N-terminal

Iprscan IPR006589 [SM00642]

173

578

Glycosyl hydrolase, family 13, subfamily, catalytic domain

Iprscan IPR011837 [TIGR02100]

17

706

Glycogen debranching enzyme GlgX

PD008556

414

540

S=404 I=61 E=2.90092e-41

PD861360

93

150

S=214 I=67 E=2.51874e-18

PD472585

542

610

S=207 I=55 E=2.07738e-17

PDA1F7Q5

366

415

S=201 I=71 E=1.04237e-16

PD203330

8

55

S=173 I=65 E=2.76071e-13

PDA1G1A6

485

540

S=168 I=61 E=1.10427e-12

PD791167

165

235

S=160 I=44 E=1.08427e-11

PDA1F8I8

56

91

S=147 I=69 E=4.07686e-10

PDA1F7Y5

290

322

S=141 I=85 E=2.08162e-09

PDA149O7

21

156

S=140 I=32 E=2.70394e-09

Iprscan IPR017853 [SSF51445]

153

589

Glycoside hydrolase, catalytic core

Iprscan IPR014756 [SSF81296]

17

172

Immunoglobulin E-set

Iprscan [SSF51011]

598

707

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one I6oXJ8QU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

168 hits
swiss-prot

Swiss-Prot ncbi-blastp

360 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr13830.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr13830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr13830.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr13830.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr28790758_3041434_r3_XFF4834R-XFF4834R_chr26330 XFF4834R_chr26330
XFF4834R_chr26320
XFF4834R_chr26320
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr26340
XFF4834R_chr26340
ID XFF4834R_chr28790758_3041434_r3_XFF4834R-XFF4834R_chr26330
AC XFF4834R_chr26330
LT XFF4834R_chr26330
OR XFF4834R_chr from 3039758 to 3041434 on strand -
DE putative cyclomaltodextrin glucanotransferase
IP Glycoside hydrolase, subgroup, catalytic core; Glycoside hydrolase, catalytic core
CL 1.2.4.1 Glycogen catabolism GO:0005980
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 61497.7 Da
SQ 558 aa
 
........10........20........30........40........50
| | | | |
MMRSAMYVALTMYAGAATAAPAAKDYYGTLEPFAAEAVYFVVTDRFVNGD
TGNDHRDQGGAHRSFDVPTPCADGSEDNIGYLGGDFKGIVEHADYIRDLG
FGAVWITPIVDNPDEAFTGGKPITCGSTLSDHGKTGYHGYWGVNFYKLDE
HLPSPGLDFAGFTRAMHASKLKVVLDIVGNHGSPAYTMPQAQPGFGKLYD
AQGRLLADHQNLAPAQLDPQHNPLHAFYNTGGGLAELSDLNENNPAVLDY
LAGAYLQWMEQGADAFRIDTIGWMPDRFWHAFVARMREKRPGFFMFGEAF
DYDADKIAGHTWTRNAGVSVLDFPLKQQLAAVFGHEQAGFEKLAAPLFLR
QGPYANPYALMSFYDNHDMARLDASDNGFIDAHNWLFTARGIPVIYYGSE
IGFMRGRAEHAGNRNYFGVERIRSAPQSPIFGPLQRIAQVRRNTPALQRG
VQLDVQLHGNQAAFLRVYQHAGTTQTALVLLNKADTAASIEVKRFLQPGS
WRDAVSGEQLQVQRRLVAQVPAHGVRVLLSDAPITDPALRKQLDLQMAEQ
AARDARNR
XFF4834R

YP_364528.1 lcl|cgt-XCV2797

2

558

S=2763 I=93 E=0

cyclomaltodextrin glucanotransferase precursor

XFF4834R

NP_642909.1 lcl|cgt-XAC2596

24

558

S=2736 I=95 E=0

cyclomaltodextrin glucanotransferase

XFF4834R

NP_637817.1 lcl|cgt-XCC2465

1

558

S=2532 I=84 E=0

cyclomaltodextrin glucanotransferase (CGTase)

pubmed

31

507

S=406 I=31 E=3.28173e-40

Cyclomaltodextrin glucanotransferase EC=2.4.1.19 ; Calcium Disulfide bond Glycosyltransferase Metal-binding Secreted Signal

Pubmed 8107143,7857935

 

prodomImg

pubmed

33

507

S=402 I=30 E=1.07416e-39

Cyclomaltodextrin glucanotransferase EC=2.4.1.19 ; Calcium Disulfide bond Glycosyltransferase Metal-binding Secreted Signal

Pubmed 1476442

 

prodomImg

pubmed

31

507

S=400 I=30 E=1.94335e-39

Cyclomaltodextrin glucanotransferase EC=2.4.1.19 ; Calcium Disulfide bond Glycosyltransferase Metal-binding Secreted Signal

Pubmed 2972812

 

prodomImg

pubmed

33

500

S=399 I=27 E=2.54643e-39

Cyclomaltodextrin glucanotransferase

Pubmed 12620618

 

prodomImg

pubmed

31

506

S=391 I=29 E=2.15589e-38

Alpha-amylase EC=3.2.1.1 ; Calcium Carbohydrate metabolism Glycosidase Hydrolase Metal-binding Signal

Pubmed 3109866

 

prodomImg

sp_Pdown

sp|P43379|CDGT2_BACCI

31

507

S=406 I=31 E=2.23357e-40

Cyclomaltodextrin glucanotransferase EC=2.4.1.19 ; Calcium Disulfide bond Glycosyltransferase Metal-binding Secreted Signal

sp_Pdown

sp|P31797|CDGT_BACST

33

507

S=402 I=30 E=7.3108e-40

Cyclomaltodextrin glucanotransferase EC=2.4.1.19 ; Calcium Disulfide bond Glycosyltransferase Metal-binding Secreted Signal

sp_Pdown

sp|P09121|CDGT_BACS3

31

507

S=400 I=30 E=1.32266e-39

Cyclomaltodextrin glucanotransferase EC=2.4.1.19 ; Calcium Disulfide bond Glycosyltransferase Metal-binding Secreted Signal

sp_Pdown

sp|P08137|AMY_BACCI

31

506

S=391 I=29 E=1.46731e-38

Alpha-amylase EC=3.2.1.1 ; Calcium Carbohydrate metabolism Glycosidase Hydrolase Metal-binding Signal

sp_Pdown

sp|P05618|CDGT_BACS0

31

507

S=388 I=29 E=3.30117e-38

Cyclomaltodextrin glucanotransferase EC=2.4.1.19 ; Calcium Disulfide bond Glycosyltransferase Metal-binding Secreted Signal

Iprscan IPR013781 [G3DSA:3.20.20.80]

28

450

Glycoside hydrolase, subgroup, catalytic core

Iprscan [PTHR10357:SF11]

38

528

-

Iprscan [PTHR10357]

38

528

-

Iprscan IPR006047 [PF00128]

84

404

Glycosyl hydrolase, family 13, catalytic domain

Iprscan IPR006589 [SM00642]

40

423

Glycosyl hydrolase, family 13, subfamily, catalytic domain

Iprscan [seg]

14

23

-

Iprscan [seg]

509

520

-

Iprscan [SignalP-NN(euk)]

1

19

-

PD715763

407

548

S=561 I=77 E=1.87552e-60

PDA1V1I5

291

355

S=302 I=88 E=4.89502e-29

PD695483

182

228

S=227 I=91 E=5.78389e-20

PDA7O612

112

181

S=192 I=49 E=9.23083e-16

PDA6T7W2

2

42

S=152 I=76 E=7.32788e-11

PD003144

44

112

S=129 I=38 E=4.93739e-08

PDA1Z6D9

112

134

S=128 I=100 E=6.35779e-08

PD628480

1

42

S=114 I=55 E=2.72452e-06

Iprscan IPR017853 [SSF51445]

30

447

Glycoside hydrolase, catalytic core

Iprscan [SSF51011]

449

531

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 5qeBBrf3)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

110 hits
swiss-prot

Swiss-Prot ncbi-blastp

48 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr26330.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr26330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr26330.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB_AeTgP/XFF4834R_chr26330.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.