Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr02880tatD1XFF4834R_chr02880Probable TatD-related deoxyribonuclease protein

tatD1 XFF4834R_chr02880
XFF4834R_chr_0319
XFF4834R_chr_0319
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02890
XFF4834R_chr02890
ID tatD1
AC XFF4834R_chr02880
LT XFF4834R_chr02880
OR XFF4834R_chr from 336197 to 337009 on strand +
DE Probable TatD-related deoxyribonuclease protein
IP Deoxyribonuclease, TatD-related; Deoxyribonuclease, TatD Mg-dependent
CL 1.2.2 DNA GO:0006308
EC
GO InterPro
producing 5'-phosphomonoesters (GO:0016888)

Curated
PM
AN
CC COG: [L] Replication, recombination and repair;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130522)
MW 30160.8 Da
SQ 270 aa
 
........10........20........30........40........50
| | | | |
MQLIDIGANLTHDSFDRDRDAVLQRARDAGVAQLVITGASREHSPLALQL
AQQHPGFLYATAGVHPHHAVEFTAECEAEMRTLQAHPQVVAVGECGLDYF
RDFAPRPAQHKAFERQLQLAADNGKPLFLHQRDAHEDFIAIMRSFEGRLG
AAVVHCFTGTRDELFAYLDRDYYIGITGWLCDERRGAHLRELVRNIPANR
LMIETDAPYLLPRTLKPMPKDRRNEPMFLSHIVEELARDRGEDVAVTAAN
STAAARAFFRLPAPASTTSG
XFF4834R

XFF4834R_chr30290 lcl|XFF4834R_chr32910808_3482575_f2_XFF4834R-XFF4834R_chr30290

1

243

S=260 I=35 E=3.96204e-25

predicted DNase

XFF4834R

XFF4834R_chr30290 lcl|XFF4834R_chr32910808_3482575_f2_XFF4834R-XFF4834R_chr30290

1

243

S=260 I=35 E=3.96204e-25

predicted DNase

pubmed

3

243

S=639 I=52 E=6.91882e-69

Deoxyribonuclease tatD EC=3.1.21.- ; Cytoplasm Hydrolase Magnesium

Pubmed 1584020,9649434

 

prodomImg

pubmed

2

243

S=638 I=52 E=9.6365e-69

MttC

Pubmed 9546395

 

prodomImg

pubmed

2

224

S=516 I=43 E=6.04757e-54

Cell death-related nuclease 2 Cell-death-related nuclease protein 2

Pubmed 12718884

 

prodomImg

pubmed

1

243

S=428 I=39 E=2.75799e-43

Sec-independent protein TatD EC=3.1.21.- ; Hydrolase

Pubmed 12446909

 

prodomImg

pubmed

3

237

S=383 I=33 E=7.29235e-38

Uncharacterized deoxyribonuclease yabD EC=3.1.21.- ; Hydrolase

Pubmed 7584024

 

prodomImg

pubmed

18

209

S=305 I=38 E=2.32807e-28

Uncharacterized deoxyribonuclease C17A3.08 EC=3.1.21.- ; Cytoplasm Hydrolase Nucleus

Pubmed 10620777

 

prodomImg

pubmed

57

238

S=291 I=39 E=1.0152e-26

Putative deoxyribonuclease TATDN2 EC=3.1.21.- ; Hydrolase Nucleus Phosphoprotein Polymorphism

Pubmed 9039502

 

prodomImg

pubmed

37

241

S=251 I=35 E=6.94894e-22

TatD-like protein

Pubmed 19246593

 

prodomImg

pubmed

3

241

S=194 I=27 E=5.27228e-15

Putative uncharacterized protein

Pubmed 9023221

 

prodomImg

pubmed

3

65

S=126 I=46 E=1.06122e-06

Twin arginine translocation protein D

Pubmed 18075090

 

prodomImg

sp_Pdown

sp|P27859|TATD_ECOLI

3

243

S=639 I=52 E=4.76998e-69

Deoxyribonuclease tatD EC=3.1.21.- ; Cytoplasm Hydrolase Magnesium

sp_Pdown

sp|P37545|YABD_BACSU

3

237

S=383 I=33 E=5.0275e-38

Uncharacterized deoxyribonuclease yabD EC=3.1.21.- ; Hydrolase

sp_Pdown

sp|Q6P1N9|TATD1_HUMAN

1

209

S=350 I=38 E=4.79699e-34

Putative deoxyribonuclease TATDN1 EC=3.1.21.- ; Alternative splicing Hydrolase Nucleus

sp_Pdown

sp|Q6P8M1|TATD1_MOUSE

1

209

S=348 I=39 E=9.72022e-34

Putative deoxyribonuclease TATDN1 EC=3.1.21.- ; Alternative splicing Hydrolase Nucleus

sp_Pdown

sp|Q640V9|TATD1_XENLA

2

209

S=346 I=40 E=1.57012e-33

Putative deoxyribonuclease TATDN1 EC=3.1.21.- ; Hydrolase Nucleus

Iprscan [G3DSA:3.20.20.140]

3

259

-

Iprscan IPR012278 [PIRSF005902]

1

263

Deoxyribonuclease, TatD Mg-dependent

Iprscan IPR015992 [PTHR10060]

25

267

Deoxyribonuclease, TatD

Iprscan IPR001130 [PF01026]

4

259

Deoxyribonuclease, TatD-related

Iprscan [seg]

244

265

-

PD403160

95

178

S=159 I=38 E=7.12937e-12

PD588826

184

241

S=131 I=46 E=1.85558e-08

PDA5S6V8

3

104

S=120 I=28 E=4.83762e-07

PDA3X5W5

30

101

S=117 I=40 E=1.127e-06

PD689796

2

44

S=112 I=47 E=4.35342e-06

Iprscan [SSF51556]

1

261

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one W0281Ezr)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBazrUIw/XFF4834R_chr02880.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBazrUIw/XFF4834R_chr02880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBazrUIw/XFF4834R_chr02880.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBazrUIw/XFF4834R_chr02880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.