Xanthomonas fuscans subsp. fuscans

6 hits

  1. XFF4834R_chr12470rphXFF4834R_chr12470probable ribonuclease PH
  2. XFF4834R_chr13880XFF4834R_chr14730988_1588383_r1_XFF4834R-XFF4834R_chr13880XFF4834R_chr13880hypothetical prot
  3. XFF4834R_chr19540XFF4834R_chr21030376_2246726_r2_XFF4834R-XFF4834R_chr19540XFF4834R_chr19540Conserved hypothetical protein
  4. XFF4834R_chr22100XFF4834R_chr24030710_2557369_r3_XFF4834R-XFF4834R_chr22100XFF4834R_chr22100probable Ribonuclease E
  5. XFF4834R_chr26790pnpXFF4834R_chr26790probable polynucleotide phosphorylase/polyadenylase
  6. XFF4834R_chr29470vacBXFF4834R_chr29470exoribonuclease R, RNase R

rph XFF4834R_chr12470
XFF4834R_chr12460
XFF4834R_chr12460
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr12480
XFF4834R_chr12480
ID rph
AC XFF4834R_chr12470
LT XFF4834R_chr12470
OR XFF4834R_chr from 1411885 to 1412610 on strand -
DE probable ribonuclease PH
IP Ribonuclease phosphorolytic, bacterial-type
CL 1.2.1 RNA GO:0006401
EC
GO InterPro
Biological Process: RNA processing (GO:0006396)
Biological Process: tRNA processing (GO:0008033)
Molecular Function: 3'-5'-exoribonuclease activity (GO:0000175)
Molecular Function: RNA binding (GO:0003723)
Molecular Function: tRNA binding (GO:0000049)
Molecular Function: tRNA-specific ribonuclease activity (GO:0004549)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100809)
MW 25887.1 Da
SQ 241 aa
 
........10........20........30........40........50
| | | | |
MTFSRPSGRTADQLRPVRIERAFTRHAEGSVLVSFGDTRVLCTASVENRV
PGFLRGKGEGWVTAEYGMLPRSTHTRSDREAARGKQGGRTLEIQRLIGRA
LRACVDRNALGERTITLDCDVLQADGGTRTAAITGAYVALADAVNLLLKR
GDIKKNPLIGAVAAVSVGIYRGEPVLDLDYPEDSDCDTDMNVVMNDGGGF
IELQGTAEGHAFRRDELNALLALAEKGMGELFALQRAALAG
XFF4834R

YP_365245.1 lcl|rph-XCV3514

1

241

S=1240 I=99 E=2.4078e-143

ribonuclease PH

XFF4834R

NP_643704.1 lcl|rph-XAC3397

1

241

S=1237 I=99 E=5.70802e-143

ribonuclease PH

XFF4834R

NP_638597.1 lcl|rph-XCC3251

1

241

S=1224 I=98 E=1.98423e-141

ribonuclease PH

XFF4834R

lcl|XALc_0795

1

230

S=1085 I=90 E=1.49295e-124

hypothetical ribonuclease ph protein

pubmed

3

240

S=883 I=71 E=1.59263e-98

Ribonuclease PH EC=2.7.7.56 ; Nucleotidyltransferase tRNA processing

Pubmed 8824606

 

prodomImg

pubmed

5

239

S=791 I=67 E=2.50501e-87

Ribonuclease PH EC=2.7.7.56 ; Nucleotidyltransferase tRNA processing

Pubmed 3882417

 

prodomImg

pubmed

5

240

S=790 I=68 E=2.85501e-87

Ribonuclease PH EC=2.7.7.56 ; Nucleotidyltransferase tRNA processing

Pubmed 6207018,1885537

 

prodomImg

pubmed

5

240

S=774 I=62 E=2.8255e-85

RNase PH

Pubmed 18028413

 

prodomImg

pubmed

2

239

S=774 I=67 E=3.19232e-85

Ribonuclease PH EC=2.7.7.56 ; Nucleotidyltransferase tRNA processing

Pubmed 16309397

 

prodomImg

sp_Pdown

sp|Q3BPR8|RNPH_XANC5

1

241

S=1240 I=99 E=6.56375e-142

Ribonuclease PH EC=2.7.7.56 ; Nucleotidyltransferase tRNA processing

sp_Pdown

sp|Q8PH63|RNPH_XANAC

1

241

S=1237 I=99 E=1.55602e-141

Ribonuclease PH EC=2.7.7.56 ; Nucleotidyltransferase tRNA processing

sp_Pdown

sp|B2SLL1|RNPH_XANOP

1

241

S=1225 I=98 E=4.58332e-140

Ribonuclease PH EC=2.7.7.56 ; Nucleotidyltransferase tRNA processing

sp_Pdown

sp|Q2P6N2|RNPH_XANOM

1

241

S=1225 I=98 E=4.58332e-140

Ribonuclease PH EC=2.7.7.56 ; Nucleotidyltransferase tRNA processing

sp_Pdown

sp|Q8P5T5|RNPH_XANCP

1

241

S=1224 I=98 E=5.40908e-140

Ribonuclease PH EC=2.7.7.56 ; Nucleotidyltransferase tRNA processing

Iprscan IPR002381 [MF_00564]

4

240

Ribonuclease phosphorolytic, bacterial-type

Iprscan [PTHR11953]

5

240

-

Iprscan IPR001247 [PF01138]

13

143

Exoribonuclease, phosphorolytic domain 1

Iprscan IPR015847 [PF03725]

160

227

Exoribonuclease, phosphorolytic domain 2

Iprscan IPR002381 [TIGR01966]

5

240

Ribonuclease phosphorolytic, bacterial-type

Iprscan IPR018336 [PS01277]

119

132

Ribonuclease PH, conserved site

PDA0X5G8

105

163

S=229 I=79 E=2.64389e-20

PD592123

153

239

S=217 I=65 E=8.57153e-19

PDA1E2N1

1

66

S=211 I=58 E=3.97634e-18

PD858583

68

103

S=149 I=81 E=1.60906e-10

PDA38821

46

67

S=118 I=100 E=8.56038e-07

PDA2C9R5

46

67

S=114 I=95 E=2.17595e-06

PD333034

5

45

S=113 I=51 E=3.70361e-06

PDA8A2G0

46

67

S=104 I=77 E=4.40548e-05

PDA8A2B0

46

67

S=103 I=82 E=5.72253e-05

PDA8A2A9

46

66

S=103 I=90 E=5.87419e-05

Iprscan IPR020568 [SSF54211]

5

143

Ribosomal protein S5 domain 2-type fold

Iprscan IPR015847 [SSF55666]

154

241

Exoribonuclease, phosphorolytic domain 2

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Wl0B7G6X)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

21 hits
swiss-prot

Swiss-Prot ncbi-blastp

462 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr12470.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr12470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr12470.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr12470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr14730988_1588383_r1_XFF4834R-XFF4834R_chr13880 XFF4834R_chr13880
XFF4834R_chr13870
XFF4834R_chr13870
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr13900
XFF4834R_chr13900
ID XFF4834R_chr14730988_1588383_r1_XFF4834R-XFF4834R_chr13880
AC XFF4834R_chr13880
LT XFF4834R_chr13880
OR XFF4834R_chr from 1587988 to 1588383 on strand -
DE hypothetical prot
IP Toxin-module SymE-like
CL 1.2.1 RNA GO:0006401
EC
GO InterPro
Biological Process: RNA metabolic process (GO:0016070)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: RNA binding (GO:0003723)
acting on ester bonds (GO:0016788)

Curated
PM
AN tres bon blast X avec Xcc pour hypothetical protein : I=58% et PCQ=98% ; 9 orthologues ; interproscan : 3 regions transmembranaires ; sur 1 partie de la seq 1 dom interpro =ipr14944 pour toxin module Sym E like et signature = unknown fonction DUF 1813 ; pas de signal peptide
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20101013)
MW 14565.6 Da
SQ 131 aa
 
........10........20........30........40........50
| | | | |
MSRTPSPTAKRSKSNAKRTATAKRATKPATDTQPMRLVPSPTFDVDNLAF
DHRPARHPDDIPPRPPRKARTPTRCTVGYAFYDAEPGRPHSQRIPSVRLR
GLWLEQLGFAVGCKLQITARAGKLVVTVVER
XFF4834R

XFF4834R_chr25470 lcl|XFF4834R_chr27880179_2940583_f2_XFF4834R-XFF4834R_chr25470

1

130

S=333 I=56 E=1.94474e-34

XFF4834R

XFF4834R_chr19540 lcl|XFF4834R_chr21030376_2246726_r2_XFF4834R-XFF4834R_chr19540

77

131

S=142 I=51 E=2.77549e-11

XFF4834R

NP_638450.1 lcl|XCC3103

1

128

S=343 I=58 E=4.66953e-35

hypothetical protein

XFF4834R

YP_365092.1 lcl|XCV3361

1

105

S=263 I=55 E=2.05827e-25

hypothetical protein

XFF4834R

NP_643554.1 lcl|XAC3246-XAC3246

35

104

S=191 I=59 E=1.28692e-16

hypothetical protein

XFF4834R

YP_361862.1 lcl|XCV0131

77

130

S=149 I=54 E=1.55254e-11

hypothetical protein

XFF4834R

lcl|XALc_2276

77

129

S=148 I=56 E=1.83226e-11

hypothetical protein

XFF4834R

lcl|XALc_2279

77

129

S=140 I=54 E=1.63455e-10

hypothetical protein

XFF4834R

NP_642240.1 lcl|XAC1914-XAC1914

77

129

S=140 I=51 E=1.87924e-10

hypothetical protein

XFF4834R

YP_363702.1 lcl|XCV1971

77

129

S=140 I=51 E=1.94594e-10

hypothetical protein

XFF4834R

NP_637261.1 lcl|XCC1896

77

129

S=138 I=51 E=2.71029e-10

hypothetical protein

XFF4834R

NP_638915.1 lcl|XCC3569

77

129

S=137 I=49 E=4.37798e-10

hypothetical protein

XFF4834R

lcl|XALc_2289

77

129

S=136 I=56 E=5.03336e-10

hypothetical protein

XFF4834R

NP_643172.1 lcl|XAC2863-XAC2863

77

131

S=134 I=49 E=8.94886e-10

hypothetical protein

XFF4834R

lcl|XALc_2286

77

130

S=134 I=50 E=1.03786e-09

hypothetical protein

Iprscan IPR014944 [PF08845]

72

128

Toxin-module SymE-like

Iprscan [seg]

16

32

-

Iprscan [seg]

51

76

-

PD628232

77

131

S=134 I=49 E=8.62244e-09

PD683529

35

105

S=122 I=42 E=2.45272e-07

PDA7Z764

105

130

S=118 I=88 E=7.29392e-07

PD756750

105

128

S=111 I=92 E=6.06851e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rHya9qqk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr13880.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr13880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr13880.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr13880.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr21030376_2246726_r2_XFF4834R-XFF4834R_chr19540 XFF4834R_chr19540
XFF4834R_chr_2087
XFF4834R_chr_2087
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4663
XFF4834R_chr_4663
ID XFF4834R_chr21030376_2246726_r2_XFF4834R-XFF4834R_chr19540
AC XFF4834R_chr19540
LT XFF4834R_chr19540
OR XFF4834R_chr from 2246376 to 2246726 on strand -
DE Conserved hypothetical protein
IP Protein of unknown function DUF1813, HSP20-like
CL 1.2.1 RNA GO:0006401
EC
GO InterPro
Biological Process: RNA metabolic process (GO:0016070)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: RNA binding (GO:0003723)
acting on ester bonds (GO:0016788)

Curated
PM
AN bons hits blastx ncbi pour conserved hypothetical protein chez xanthos ; 1 hit interpro toxin-module SymE like (but only module) =SOS induced gene , cleavage RNA, recycling RNAs damaged under SAS inducing conditions , SymE repressed.
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by bonneau (20101013)
MW 13373.4 Da
SQ 116 aa
 
........10........20........30........40........50
| | | | |
MRQPPSRTTTRKRARRQPPRDAVWRIKESPLTPMLTPEEIEAANAADLVK
QRRVVRRPRPPQQLTVGYGYYPASDQRVPTLRLRGRWLEQLGFVIGSKIS
IRMRDGELVVSLASRS
XFF4834R

XFF4834R_chr25470 lcl|XFF4834R_chr27880179_2940583_f2_XFF4834R-XFF4834R_chr25470

64

116

S=153 I=52 E=1.19262e-12

XFF4834R

XFF4834R_chr13880 lcl|XFF4834R_chr14730988_1588383_r1_XFF4834R-XFF4834R_chr13880

64

115

S=152 I=51 E=1.38316e-12

XFF4834R

NP_643172.1 lcl|XAC2863-XAC2863

1

116

S=311 I=61 E=2.28386e-31

hypothetical protein

XFF4834R

lcl|XALc_2286

1

114

S=229 I=51 E=2.42848e-21

hypothetical protein

XFF4834R

lcl|XALc_2289

1

113

S=226 I=52 E=4.79382e-21

hypothetical protein

XFF4834R

lcl|XALc_2279

1

113

S=225 I=51 E=7.87975e-21

hypothetical protein

XFF4834R

YP_361862.1 lcl|XCV0131

64

113

S=221 I=80 E=1.98555e-20

hypothetical protein

XFF4834R

lcl|XALc_2276

1

114

S=217 I=48 E=6.06114e-20

hypothetical protein

XFF4834R

NP_638450.1 lcl|XCC3103

64

112

S=150 I=54 E=7.48714e-12

hypothetical protein

XFF4834R

NP_642240.1 lcl|XAC1914-XAC1914

10

112

S=137 I=33 E=3.32235e-10

hypothetical protein

XFF4834R

YP_363702.1 lcl|XCV1971

64

112

S=131 I=48 E=1.72621e-09

hypothetical protein

XFF4834R

NP_637261.1 lcl|XCC1896

10

112

S=126 I=31 E=6.21886e-09

hypothetical protein

Iprscan IPR014944 [PF08845]

61

112

Protein of unknown function DUF1813, HSP20-like

Iprscan [seg]

49

63

-

PD628232

1

116

S=311 I=61 E=2.72591e-30

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ESS8Exqv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr19540.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr19540.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr19540.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr19540.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr24030710_2557369_r3_XFF4834R-XFF4834R_chr22100 XFF4834R_chr22100
XFF4834R_chr22090
XFF4834R_chr22090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_2354
XFF4834R_chr_2354
ID XFF4834R_chr24030710_2557369_r3_XFF4834R-XFF4834R_chr22100
AC XFF4834R_chr22100
LT XFF4834R_chr22100
OR XFF4834R_chr from 2553710 to 2557369 on strand -
DE probable Ribonuclease E
IP Ribonuclease E/G; Nucleic acid-binding, OB-fold-like
CL 1.2.1 RNA GO:0006401
EC
GO InterPro
Biological Process: RNA processing (GO:0006396)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: ribonuclease activity (GO:0004540)
Molecular Function: RNA binding (GO:0003723)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100812)
MW 127880.6 Da
SQ 1219 aa
 
........10........20........30........40........50
| | | | |
MKRMLINATQAEELRVAIVDGQTLYDIDIEQPSKEQKKSNIYKGRITRLE
PSLEAAFVDYGAERHGFLPLKEISRDYFQAGVDHNKSTIRELLREGQEIV
VQVDKEERGNKGAALTTFISLAGRYMVLMPNSPSAGGVSRRIEGEDRAAL
KEALDKLDIPDDMGVIIRTAGVGRDAEELQWDLDYLLQTWKAIAEAALSK
PAAFLIYQESRLIIRALRDYLRADVGEILVDTPELYADAQEFMKQVMPQS
LRKLKHYTDDIPLFNRFQIESQIEGAYERNVRLPSGGSIVVDQTEALTAV
DVNSSRATKGSDIEETAFQTNLEAAEEVARQLRLRDLGGLVVIDFIDMAS
SKHQREVENRLQNALKYDRARVQLGRISRFGLMEMSRQRLRPSLGESSQI
VCPRCDGHGRMRSVESLSLSIIRVAEEHAMKENTGQVLVQAPVEIANYLL
NEKRSALREIEQRHESPIIIVADEQLHTPHYEVTRLRENELGEESGKPSY
QRGTPRKLPVHALTKAQLNIPAAPAVTSIKPSQPAPVREEAPAPVAPVAA
PAPVVTVPIPAPVTGVVGWLKRIFGGVEPIAPAPESTPRPRQNDAGRNNR
SERGERGGQRRDARNGGNQQRGNGGNGNGANKERRDERRQPGNAQGAQNG
AQAQQQVQVPKPPRSEAQAPKPQQQKPKPQNQSPRPPRGPAQQDGAPAER
QPRPARQDEGTAAAQTLTPTAATATTSSVVSAIADAAAAAPTNAQTNANE
AVQAHPVDVTVIESTADRGADANAAAPAPDAAGDDAANGEGGSRRRRGRR
GGRRRRRGAGANGEGGASVDGLDGDDLDSDADNDLDGDSEGDDAGMQAHA
SAAPRAGQPEFDFDDEAPAPAVRAKPEPAAQATAKARPVPKERAEPQIGS
DTASTTAPVSNTVPASQPSATPGANADTARERPAAPVAATDATAKPAPAA
TASTVAGTDGAAAQAAEQRPVTVAQQASATLAPIAAPAPVVSTPAAAVAP
AAGAAPTAPVAAAVAPAPAVASPVTSNAATSSQQRPSAPATAAAPAAAQA
AKPDQQQPAASADVETPPVQATPVQPARGTPAEDLSAPAAASPASQAAVV
TVTSPHAEQSASQTPSSEVAMTSTSTVVQASPSADTAPVRKPYAPVQTTM
LDALSPNDAAPAASSASKPPAAAPAAAQESQADKPKPTVIVSEAVKPVAP
SAEADQAQGDDSSKPRGDH
XFF4834R

XFF4834R_chr18620 lcl|rng-XFF4834R_chr18620

4

486

S=714 I=37 E=2.40941e-79

ribonuclease G

XFF4834R

NP_642428.1 lcl|rne-XAC2111

1

765

S=3042 I=79 E=0

ribonuclease E

XFF4834R

NP_642428.1 lcl|rne-XAC2111

1063

1219

S=418 I=61 E=6.25074e-43

ribonuclease E

XFF4834R

NP_642428.1 lcl|rne-XAC2111

846

932

S=402 I=92 E=6.02643e-41

ribonuclease E

XFF4834R

YP_364154.1 lcl|rne-XCV2423

1

765

S=3009 I=78 E=0

ribonuclease E

XFF4834R

YP_364154.1 lcl|rne-XCV2423

847

917

S=316 I=90 E=1.49285e-30

ribonuclease E

XFF4834R

YP_364154.1 lcl|rne-XCV2423

1106

1219

S=290 I=65 E=1.91751e-27

ribonuclease E

XFF4834R

NP_637449.1 lcl|rne-XCC2084

1

595

S=2859 I=91 E=0

ribonuclease E

XFF4834R

NP_637449.1 lcl|rne-XCC2084

848

916

S=128 I=55 E=9.06602e-08

ribonuclease E

XFF4834R

NP_637449.1 lcl|rne-XCC2084

1106

1152

S=122 I=58 E=4.6696e-07

ribonuclease E

XFF4834R

lcl|rne-XALc_1617

1

592

S=2696 I=86 E=0

probable ribonuclease e protein

XFF4834R

lcl|CafA-XALc_2460

4

486

S=726 I=38 E=3.15396e-80

putative ribonucleases g and e protein

XFF4834R

NP_643079.2 lcl|rng-XAC2770

4

486

S=719 I=37 E=2.12864e-79

ribonuclease G

XFF4834R

YP_364658.1 lcl|rng-XCV2927

4

486

S=714 I=37 E=8.89382e-79

ribonuclease G

XFF4834R

NP_637957.1 lcl|rng-XCC2609

4

486

S=710 I=37 E=2.48826e-78

ribonuclease G

pubmed

4

501

S=1785 I=65 E=0

Putative ribonuclease E

Pubmed 19345289

 

prodomImg

pubmed

1

486

S=1747 I=67 E=0

Cell shape determining protein homolog

Pubmed 8320240

 

prodomImg

pubmed

4

461

S=725 I=40 E=1.88675e-78

Ribonuclease G EC=3.1.26.- ; Cell cycle division Cytoplasm Cytoskeleton Endonuclease Hydrolase

Pubmed 1937035

 

prodomImg

pubmed

93

416

S=534 I=36 E=2.74009e-55

Putative endoribonuclease E

Pubmed 18515828

 

prodomImg

pubmed

93

416

S=532 I=36 E=4.5832e-55

Endoribonuclease E

Pubmed 18515828

 

prodomImg

sp_Pdown

sp|P21513|RNE_ECOLI

1

500

S=1783 I=66 E=0

Ribonuclease E EC=3.1.26.12 ; Cytoplasm Endonuclease Hydrolase RNA-binding

sp_Pdown

sp|P44443|RNE_HAEIN

1

501

S=1757 I=66 E=0

Ribonuclease E EC=3.1.26.12 ; Cytoplasm Endonuclease Hydrolase RNA-binding

sp_Pdown

sp|Q8K9J9|RNE_BUCAP

1

518

S=1678 I=60 E=0

Ribonuclease E EC=3.1.26.12 ; Cytoplasm Endonuclease Hydrolase RNA-binding

sp_Pdown

sp|P57429|RNE_BUCAI

1

490

S=1616 I=62 E=0

Ribonuclease E EC=3.1.26.12 ; Cytoplasm Endonuclease Hydrolase RNA-binding

sp_Pdown

sp|Q89AH3|RNE_BUCBP

1

390

S=1237 I=57 E=1.24165e-140

Putative truncated ribonuclease E EC=3.1.26.12 ; Cytoplasm Endonuclease Hydrolase RNA-binding

Iprscan IPR012340 [G3DSA:2.40.50.140]

30

124

Nucleic acid-binding, OB-fold

Iprscan IPR019307 [PF10150]

120

391

RNA-binding protein AU-1/Ribonuclease E/G

Iprscan IPR003029 [PF00575]

36

117

Ribosomal protein S1, RNA binding domain

Iprscan [SM00316]

37

118

-

Iprscan IPR004659 [TIGR00757]

13

423

Ribonuclease E/G

Iprscan IPR003029 [PS50126]

39

118

Ribosomal protein S1, RNA binding domain

Iprscan [seg]

534

568

-

Iprscan [seg]

596

631

-

Iprscan [seg]

640

660

-

Iprscan [seg]

668

687

-

Iprscan [seg]

711

751

-

Iprscan [seg]

766

845

-

Iprscan [seg]

933

956

-

Iprscan [seg]

961

966

-

Iprscan [seg]

977

1062

-

Iprscan [seg]

1086

1105

-

Iprscan [seg]

1153

1182

-

PD007819

154

318

S=469 I=52 E=4.4726e-49

PDA1E5K4

319

409

S=317 I=67 E=1.29885e-30

PDA2P0J3

1063

1149

S=243 I=70 E=1.06412e-21

PD383053

2

79

S=243 I=60 E=1.2128e-21

PD138406

411

486

S=236 I=61 E=8.47578e-21

PD324859

486

533

S=219 I=88 E=1.05225e-18

PD602622

848

900

S=191 I=74 E=2.34092e-15

PD654159

1183

1219

S=160 I=84 E=1.50873e-11

PDA0A3K9

283

394

S=157 I=37 E=2.92675e-11

PDA1F6X7

96

132

S=136 I=76 E=1.02546e-08

Iprscan IPR016027 [SSF50249]

39

124

Nucleic acid-binding, OB-fold-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one k96PcOxR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

13 hits
swiss-prot

Swiss-Prot ncbi-blastp

14 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr22100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr22100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr22100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr22100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pnp XFF4834R_chr26790
XFF4834R_chr26780
XFF4834R_chr26780
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr26800
XFF4834R_chr26800
ID pnp
AC XFF4834R_chr26790
LT XFF4834R_chr26790
OR XFF4834R_chr from 3091253 to 3093367 on strand -
DE probable polynucleotide phosphorylase/polyadenylase
IP Polyribonucleotide nucleotidyltransferase
CL 1.2.1 RNA GO:0006401
EC
GO InterPro
Biological Process: mRNA catabolic process (GO:0006402)
Biological Process: RNA processing (GO:0006396)
Cellular Component: mitochondrion (GO:0005739)
Molecular Function: polyribonucleotide nucleotidyltransferase activity (GO:0004654)
Molecular Function: RNA binding (GO:0003723)
Molecular Function: 3'-5'-exoribonuclease activity (GO:0000175)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100819)
MW 75467.8 Da
SQ 704 aa
 
........10........20........30........40........50
| | | | |
MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKFDDTVLLVTAVAAKSAR
EGQDFFPLTVDYQEKFYAGGRIPGGFFKREGRATEKETLISRLIDRPIRP
LFPEDYKNEVQIIATVMSMNPDIDGDIAALIGASAALSLAGTPFKGPIGA
AKVGYKNGEYILNPTVTELKDSQLELVVAGTANAVLMVESEADLLSEEVM
LGAVTFGHREMQKVINVINELTVEAGTKPSDWVAPAKNDGMIAALKEAVG
DQLASAFQVRDKLQRRDAISAIKKDVLGALAPRATIEGWAAGDLAKEFGE
LEYQTMRGSVLSTKVRIDGRALDTVRPISATAGVLPRTHGSALFTRGETQ
AIVITTLGTARDGQVIDAVSGEYKENFLFHYNFPPYSVGECGRFGAPKRR
EIGHGRLAKRGVLAVMPTLEEFPYTIRVVSEITESNGSSSMASVCGSSLA
LMDAGVPIKAPVAGIAMGLVKEGNDFVVLSDILGDEDHLGDMDFKVAGTA
EGVSALQMDIKIEGITEEIMKQALQQAKAGRLHILGEMAHALTTPRQELS
DYAPRLLTIKIHPDKIREVIGKGGSTIQAITKETGTQIDIQDDGTIIIAS
VNAIAAQAAKSRIEQITSDVEPGRIYEGKVAKIMDFGAFVTILPGKDGLV
HVSQISSERVEKVGDKLKEGDLVRVKVLEVDKQGRIRLSIKAVEEGEGVQ
ASAE
XFF4834R

XFF4834R_chr21580 lcl|XFF4834R_chr23500246_2502606_f1_XFF4834R-XFF4834R_chr21580

613

704

S=151 I=42 E=1.96574e-11

predicted transcriptional accessory protein

XFF4834R

XFF4834R_chr23010 lcl|rpsA-XFF4834R_chr23010

614

695

S=119 I=35 E=1.39445e-07

30S ribosomal subunit protein S1

XFF4834R

XFF4834R_chr23010 lcl|rpsA-XFF4834R_chr23010

624

693

S=118 I=44 E=2.33241e-07

30S ribosomal subunit protein S1

XFF4834R

XFF4834R_chr23010 lcl|rpsA-XFF4834R_chr23010

628

695

S=107 I=41 E=4.76361e-06

30S ribosomal subunit protein S1

XFF4834R

XFF4834R_chr23010 lcl|rpsA-XFF4834R_chr23010

623

697

S=96 I=36 E=9.39553e-05

30S ribosomal subunit protein S1

XFF4834R

NP_642994.1 lcl|pnp-XAC2683

1

704

S=3247 I=91 E=0

polynucleotide phosphorylase/polyadenylase

XFF4834R

YP_364564.1 lcl|pnp-XCV2833

1

704

S=3242 I=91 E=0

polynucleotide phosphorylase/polyadenylase

XFF4834R

lcl|pnp-XALc_1020

1

701

S=3128 I=86 E=0

probable polynucleotide phosphorylase protein

XFF4834R

NP_637857.1 lcl|pnp-XCC2507

1

704

S=3113 I=86 E=0

polynucleotide phosphorylase/polyadenylase

XFF4834R

NP_637510.1 lcl|tex-XCC2154

613

704

S=150 I=43 E=1.12486e-10

transcription-related protein

XFF4834R

YP_363945.1 lcl|tex-XCV2214

613

691

S=150 I=46 E=1.13471e-10

transcription-related protein

XFF4834R

NP_642379.1 lcl|tex-XAC2053

613

691

S=150 I=46 E=1.15467e-10

transcription-related protein

XFF4834R

lcl|tex-XALc_1636

613

689

S=149 I=46 E=1.20612e-10

putative transcription-related protein

XFF4834R

YP_364227.1 lcl|rpsA-XCV2496

614

695

S=120 I=35 E=4.897e-07

30S ribosomal protein S1

XFF4834R

YP_364227.1 lcl|rpsA-XCV2496

624

693

S=118 I=44 E=8.26267e-07

30S ribosomal protein S1

XFF4834R

YP_364227.1 lcl|rpsA-XCV2496

628

695

S=107 I=41 E=1.73225e-05

30S ribosomal protein S1

XFF4834R

NP_642615.1 lcl|rpsA-XAC2298

614

695

S=119 I=35 E=5.15999e-07

30S ribosomal protein S1

XFF4834R

NP_642615.1 lcl|rpsA-XAC2298

624

693

S=118 I=44 E=8.78266e-07

30S ribosomal protein S1

XFF4834R

NP_642615.1 lcl|rpsA-XAC2298

628

695

S=107 I=41 E=1.79373e-05

30S ribosomal protein S1

XFF4834R

NP_637550.1 lcl|rpsA-XCC2194

614

695

S=119 I=35 E=5.63007e-07

30S ribosomal protein S1

XFF4834R

NP_637550.1 lcl|rpsA-XCC2194

624

693

S=117 I=44 E=9.49958e-07

30S ribosomal protein S1

XFF4834R

NP_637550.1 lcl|rpsA-XCC2194

628

695

S=107 I=41 E=1.87365e-05

30S ribosomal protein S1

XFF4834R

lcl|rpsA-XALc_1602

614

695

S=118 I=35 E=7.31323e-07

30s ribosomal protein s1

XFF4834R

lcl|rpsA-XALc_1602

624

693

S=117 I=44 E=9.66668e-07

30s ribosomal protein s1

XFF4834R

lcl|rpsA-XALc_1602

628

695

S=107 I=40 E=1.87365e-05

30s ribosomal protein s1

pubmed

1

693

S=2064 I=58 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding

Pubmed 10873488

 

prodomImg

pubmed

4

700

S=2052 I=58 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding Stress response

Pubmed 8206856

 

prodomImg

pubmed

4

695

S=2038 I=58 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding

Pubmed 12072563

 

prodomImg

pubmed

4

695

S=2031 I=59 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding Stress response

Pubmed 2432069

 

prodomImg

pubmed

1

691

S=2006 I=58 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding

Pubmed 9632258

 

prodomImg

sp_Pdown

sp|Q8PJ59|PNP_XANAC

1

704

S=3247 I=91 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding

sp_Pdown

sp|Q3BRP9|PNP_XANC5

1

704

S=3242 I=91 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding

sp_Pdown

sp|Q5GXV3|PNP_XANOR

1

704

S=3216 I=90 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding

sp_Pdown

sp|B2SVJ9|PNP_XANOP

1

704

S=3216 I=90 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding

sp_Pdown

sp|Q2P0X5|PNP_XANOM

1

704

S=3216 I=90 E=0

Polyribonucleotide nucleotidyltransferase EC=2.7.7.8 ; Cytoplasm RNA-binding

Iprscan IPR015848 [G3DSA:1.10.10.400]

236

320

Polynucleotide phosphorylase, phosphorolytic RNA-binding, bacterial/organelle-type

Iprscan IPR012340 [G3DSA:2.40.50.140]

618

693

Nucleic acid-binding, OB-fold

Iprscan IPR012162 [MF_01595]

2

694

Polyribonucleotide nucleotidyltransferase

Iprscan IPR012162 [PIRSF005499]

1

703

Polyribonucleotide nucleotidyltransferase

Iprscan IPR012162 [PTHR11252]

144

696

Polyribonucleotide nucleotidyltransferase

Iprscan IPR001247 [PF01138]

15

143

Exoribonuclease, phosphorolytic domain 1

Iprscan IPR001247 [PF01138]

325

457

Exoribonuclease, phosphorolytic domain 1

Iprscan IPR015847 [PF03725]

146

209

Exoribonuclease, phosphorolytic domain 2

Iprscan IPR015847 [PF03725]

460

530

Exoribonuclease, phosphorolytic domain 2

Iprscan IPR003029 [PF00575]

621

691

Ribosomal protein S1, RNA binding domain

Iprscan IPR015848 [PF03726]

243

320

Polynucleotide phosphorylase, phosphorolytic RNA-binding, bacterial/organelle-type

Iprscan IPR018111 [PF00013]

558

613

K Homology, type 1, subgroup

Iprscan IPR004087 [SM00322]

553

618

K Homology

Iprscan [SM00316]

621

691

-

Iprscan IPR012162 [TIGR03591]

9

693

Polyribonucleotide nucleotidyltransferase

Iprscan IPR004088 [PS50084]

554

613

K Homology, type 1

Iprscan IPR003029 [PS50126]

623

691

Ribosomal protein S1, RNA binding domain

Iprscan [seg]

122

141

-

Iprscan [seg]

435

448

-

Iprscan [seg]

584

609

-

PD002075

431

550

S=413 I=69 E=1.9255e-42

PD699318

4

87

S=325 I=71 E=1.14064e-31

PDA1F6X9

357

430

S=279 I=69 E=3.55933e-26

PD384471

89

186

S=277 I=57 E=5.9535e-26

PDA1L0Y7

234

299

S=253 I=79 E=5.12051e-23

PD594032

625

691

S=154 I=53 E=4.64618e-11

PD333034

298

353

S=152 I=50 E=1.05445e-10

PD482680

180

273

S=136 I=45 E=7.17292e-09

Iprscan IPR020568 [SSF54211]

1

143

Ribosomal protein S5 domain 2-type fold

Iprscan IPR020568 [SSF54211]

323

459

Ribosomal protein S5 domain 2-type fold

Iprscan IPR015847 [SSF55666]

460

551

Exoribonuclease, phosphorolytic domain 2

Iprscan IPR015847 [SSF55666]

144

237

Exoribonuclease, phosphorolytic domain 2

Iprscan [SSF54791]

541

651

-

Iprscan IPR016027 [SSF50249]

620

704

Nucleic acid-binding, OB-fold-like

Iprscan IPR015848 [SSF46915]

237

322

Polynucleotide phosphorylase, phosphorolytic RNA-binding, bacterial/organelle-type

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ouRfyb4d)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

140 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

27 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr26790.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr26790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr26790.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr26790.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
vacB XFF4834R_chr29470
XFF4834R_chr_3110
XFF4834R_chr_3110
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3112
XFF4834R_chr_3112
ID vacB
AC XFF4834R_chr29470
LT XFF4834R_chr29470
OR XFF4834R_chr from 3384624 to 3387152 on strand -
DE exoribonuclease R, RNase R
IP Ribonuclease II/ribonuclease R, bacteria; Nucleic acid-binding, OB-fold-like
CL 1.2.1 RNA GO:0006401
EC
GO InterPro
Biological Process: RNA metabolic process (GO:0016070)
Molecular Function: ribonuclease activity (GO:0004540)
Molecular Function: nuclease activity (GO:0004518)
Molecular Function: nucleic acid binding (GO:0003676)
Molecular Function: RNA binding (GO:0003723)

Curated
PM
AN
CC COG: [K] Transcription;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 93141.3 Da
SQ 842 aa
 
........10........20........30........40........50
| | | | |
MTKKKTPDSDRPSRRKSTGAGDSSTAEQQKLPGWMPDFLVRAAAGASTKS
ANKRAADKASNASKASPQPATAPPAPRAPHPRKSGPSAPPPERFQTAAPA
AAEFKDPHAEREALRYAEPIASREAILQLLEACDGPQTAEEIAEQLNLSD
RIDALGKRLAAMVREAQLVQNRRGGYAPVQQTSLIAGVIIANPEGFGFLK
PDEGGDDLFLPPFEMRKVMHGDRALANVTGIDRRGRREGAIARVLERGMS
RMLGRFFYEHGVAYVDPDDKRIQRNVQIAPDGIGEAREGQLVVCELIAPP
DARRPAIGKIIAVLGDKLTPSLVVEMAIHGHELPHEFPQEVLDEAAAVPL
VVEPQMIGGRVDLRQMPLVTIDGEDAKDFDDAVYCEPNADGFHLVVAIAD
VSNYVRPGTPLDDEAQKRATSVYFPGFVVPMLPETLSNGICSLMPKVDRM
CFVCDMQVGRDGEVTGSRFYEAVMNSHARLTYNQVWKAVGEDDADTKAFI
GPLLPQVQRLHQLYHLLSKARTQRGAIEFETSEVRFVLDNTGEVTQAGML
VRNDAHKLIEECMIAANVEAARYLLSVHVPAPYRVHERPPESKYEDLLEF
LKEFQLSLPAWSKVRPGDYTKLLKKVRARPDAALLESVLLRSQSLAVYSP
ENNGHFGLALEAYAHFTSPIRRYPDLLVHRAIKHALTGASPQTFIYTPRQ
MAALALQCSERGRRADEAEREVDERYRAAWMEKHVGGQFDGVISGVTGFG
LFVELTQSKVNGLVHVTQLPQDYYQFDPIRKTLSGERRGREFRLGDPVRV
LVLKASMEERKIDFRLAEENGGAPEAPLPPREKPTKRKKKSY
XFF4834R

NP_641899.2 lcl|vacB-XAC1567

1

826

S=4034 I=93 E=0

RNase R

XFF4834R

YP_363338.1 lcl|vacB-XCV1607

1

826

S=4011 I=92 E=0

RNase R

XFF4834R

NP_636888.2 lcl|vacB-XCC1517

1

824

S=3832 I=89 E=0

RNase R

XFF4834R

lcl|rnr-XALc_2000

91

825

S=3069 I=79 E=0

probable rnase r protein

pubmed

105

819

S=1658 I=46 E=0

Exoribonuclease R ; Exonuclease Hydrolase RNA-binding

Pubmed 18344363

 

prodomImg

pubmed

95

529

S=1008 I=47 E=5.23055e-113

Ribonuclease R EC=3.1.-.- ; Exonuclease Hydrolase

Pubmed 1317860

 

prodomImg

pubmed

270

805

S=856 I=39 E=1.54568e-94

Virulence-associated protein ; Exonuclease Hydrolase RNA-binding

Pubmed 17306588

 

prodomImg

pubmed

323

812

S=838 I=37 E=1.91892e-92

Predicted exoribonuclease R

Pubmed 14566056

 

prodomImg

pubmed

360

812

S=825 I=39 E=7.40631e-91

Predicted exoribonuclease

Pubmed 10988064

 

prodomImg

pubmed

403

707

S=762 I=51 E=3.7925e-83

Exoribonuclease R

Pubmed 16380199

 

prodomImg

pubmed

703

821

S=218 I=39 E=3.17672e-17

Exoribonuclease R

Pubmed 16380199

 

prodomImg

pubmed

187

814

S=647 I=30 E=3.2889e-69

Ribonuclease R 2 EC=3.1.-.- ; Exonuclease Hydrolase RNA-binding

Pubmed 1400209

 

prodomImg

pubmed

336

814

S=625 I=35 E=1.34815e-66

Putative ribonuclease

Pubmed 16923877

 

prodomImg

pubmed

181

690

S=522 I=32 E=4.72531e-54

Exoribonuclease 2 EC=3.1.13.1 ; Cytoplasm Exonuclease Hydrolase RNA-binding

Pubmed 8497196

 

prodomImg

sp_Pdown

sp|P21499|RNR_ECOLI

105

816

S=1698 I=47 E=0

Ribonuclease R EC=3.1.-.- ; Acetylation Exonuclease Hydrolase RNA-binding Virulence

sp_Pdown

sp|P30851|RNR_SHIFL

105

816

S=1693 I=47 E=0

Ribonuclease R EC=3.1.-.- ; Acetylation Exonuclease Hydrolase RNA-binding Virulence

sp_Pdown

sp|P44907|RNR_HAEIN

105

816

S=1680 I=47 E=0

Ribonuclease R EC=3.1.-.- ; Exonuclease Hydrolase RNA-binding

sp_Pdown

sp|Q9KNY1|RNR_VIBCH

106

818

S=1612 I=45 E=0

Ribonuclease R EC=3.1.-.- ; Exonuclease Hydrolase RNA-binding

sp_Pdown

sp|P40611|RNR_VIBPA

105

818

S=1592 I=44 E=0

Ribonuclease R EC=3.1.-.- ; Exonuclease Hydrolase RNA-binding

Iprscan IPR012340 [G3DSA:2.40.50.140]

736

818

Nucleic acid-binding, OB-fold

Iprscan IPR013223 [PF08206]

187

244

Ribonuclease B, OB region N-terminal

Iprscan IPR001900 [PF00773]

360

688

Ribonuclease II/R

Iprscan IPR003029 [PF00575]

732

817

Ribosomal protein S1, RNA binding domain

Iprscan IPR011129 [SM00357]

186

245

Cold shock protein

Iprscan [SM00316]

734

817

-

Iprscan IPR011805 [TIGR02063]

120

818

Ribonuclease R, bacterial

Iprscan IPR004476 [TIGR00358]

167

817

Ribonuclease II/ribonuclease R, bacteria

Iprscan IPR001900 [PS01175]

655

679

Ribonuclease II/R

Iprscan IPR003029 [PS50126]

736

817

Ribosomal protein S1, RNA binding domain

Iprscan [seg]

49

83

-

Iprscan [seg]

710

729

-

Iprscan [seg]

827

840

-

PD139380

535

682

S=318 I=49 E=6.73633e-31

PD003098

360

452

S=291 I=60 E=1.06665e-27

PD684283

233

349

S=242 I=43 E=1.1086e-21

PD668593

35

128

S=225 I=58 E=1.34077e-19

PDA0V6O4

440

539

S=176 I=39 E=9.41278e-14

PD220661

184

237

S=166 I=59 E=1.68675e-12

PDA2R1Q8

1

34

S=162 I=91 E=5.1941e-12

PDA0Y884

739

818

S=159 I=48 E=1.23133e-11

PDA087H9

115

344

S=157 I=25 E=1.83888e-11

PDA1T4B1

591

622

S=150 I=84 E=1.57049e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ejW2t1hL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

29 hits
swiss-prot

Swiss-Prot ncbi-blastp

124 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

17 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr29470.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr29470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr29470.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBuHoXts/XFF4834R_chr29470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.