Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr07420frmAXFF4834R_chr07420Probable formaldehyde dehydrogenase (Glutathione) FrmA
  2. XFF4834R_chr07430XFF4834R_chr07840950_0859525_f2_XFF4834R-XFF4834R_chr07430XFF4834R_chr07430glutathione-dependent formaldehyde-activating enzyme
  3. XFF4834R_chr07440frmBXFF4834R_chr07440probable S-formylglutathione hydrolase FrmB

frmA XFF4834R_chr07420
XFF4834R_chr07410
XFF4834R_chr07410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07430
XFF4834R_chr07430
ID frmA
AC XFF4834R_chr07420
LT XFF4834R_chr07420
OR XFF4834R_chr from 857772 to 858881 on strand +
DE Probable formaldehyde dehydrogenase (Glutathione) FrmA
IP Alcohol dehydrogenase, zinc-containing, conserved site; Alcohol dehydrogenase class III/S-(hydroxymethyl)glutathione dehydrogenase;
CL 1.1.5.7 Formaldehyde degradation
EC
GO InterPro
Biological Process: ethanol oxidation (GO:0006069)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: S-(hydroxymethyl)glutathione dehydrogenase activity (GO:0051903)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN also in class 1.1.5.2 for ethanbol degradation
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 39082.7 Da
SQ 369 aa
 
........10........20........30........40........50
| | | | |
MKSRAAVAFGPGKPLEIVEIDVAPPKAGEVLVRITHTGVCHTDAFTLSGD
DPEGIFPSVLGHEGGGIVEQVGEGVTSVKVGDHVIPLYTAECRKCKFCLS
GKTNLCQAVRATQGKGLMPDGTTRFSYNGEPIYHYMGCSTFSEYTVVPEI
SLAVVNPEAPLEKVCLLGCGVTTGIGAVHNTAKVKPGESVAVFGLGGIGL
AVIQGAVQAKAGRILAIDTNPGKFDLARSMGATDCINPKDYDKPIQEVIV
ELTDGGVDFSFECIGNVNVMRSALECCHKGWGESVIIGVAGAGQEISTRP
FQLVTGRVWRGSAFGGVKGRTQLPGMVEQSMKGEIDLDPFITHTMPLEEI
NEAFHLMHEGKSIRTVIHF
XFF4834R

XFF4834R_chr06610 lcl|XFF4834R_chr_0753670_0754776_f1_XFF4834R-XFF4834R_chr06610

1

369

S=1236 I=61 E=3.01082e-143

XFF4834R

XFF4834R_chr36380 lcl|XFF4834R_chr39550802_4213965_f1_XFF4834R-XFF4834R_chr36380

29

265

S=184 I=29 E=1.0644e-15

predicted oxidoreductase, Zn-dependent and NAD(P)-binding

XFF4834R

XFF4834R_chr10280 lcl|tdh-XFF4834R_chr10280

4

369

S=165 I=23 E=1.74667e-13

threonine 3-dehydrogenase, NAD(P)-binding

XFF4834R

XFF4834R_chr18010 lcl|XFF4834R_chr19230687_2062727_r2_XFF4834R-XFF4834R_chr18010

16

266

S=123 I=25 E=2.23979e-08

XFF4834R

XFF4834R_chr17360 lcl|XFF4834R_chr18520017_1987024_f2_XFF4834R-XFF4834R_chr17360

162

360

S=122 I=28 E=3.11957e-08

XFF4834R

XFF4834R_chr21310 lcl|XFF4834R_chr23210834_2474003_f3_XFF4834R-XFF4834R_chr21310

29

265

S=116 I=23 E=1.784e-07

XFF4834R

XFF4834R_chr00320 lcl|XFF4834R_chr_0036417_0037475_f3_XFF4834R-XFF4834R_chr00320

13

357

S=115 I=26 E=1.99811e-07

predicted oxidoreductase, Zn-dependent and NAD(P)-binding

XFF4834R

XFF4834R_chr24890 lcl|XFF4834R_chr27210568_2873569_f2_XFF4834R-XFF4834R_chr24890

123

242

S=99 I=31 E=2.08366e-05

XFF4834R

XFF4834R_chr06610 lcl|XFF4834R_chr_0753670_0754776_f1_XFF4834R-XFF4834R_chr06610

1

369

S=1236 I=61 E=3.01082e-143

XFF4834R

XFF4834R_chr36380 lcl|XFF4834R_chr39550802_4213965_f1_XFF4834R-XFF4834R_chr36380

29

265

S=184 I=29 E=1.0644e-15

predicted oxidoreductase, Zn-dependent and NAD(P)-binding

XFF4834R

YP_362519.1 lcl|XCV0788

1

369

S=1852 I=96 E=0

putative alcohol dehydrogenase class III

XFF4834R

NP_641087.1 lcl|XAC0734-XAC0734

1

369

S=1846 I=95 E=0

alcohol dehydrogenase C

XFF4834R

NP_638735.1 lcl|XCC3389

1

369

S=1828 I=95 E=0

alcohol dehydrogenase C

XFF4834R

lcl|XALc_0862

1

369

S=1721 I=88 E=0

putative alcohol dehydrogenase class III protein

XFF4834R

NP_638821.1 lcl|adhC-XCC3475

1

369

S=1252 I=62 E=1.58687e-144

alcohol dehydrogenase class III

XFF4834R

NP_641005.1 lcl|adhC-XAC0652

1

369

S=1237 I=61 E=9.63798e-143

alcohol dehydrogenase class III

XFF4834R

YP_362444.1 lcl|XCV0713

1

369

S=1232 I=61 E=4.31783e-142

putative alcohol dehydrogenase class III

XFF4834R

lcl|XALc_1049

4

369

S=212 I=27 E=1.45351e-18

putative zinc-containing alcohol dehydrogenase superfamily protein

XFF4834R

YP_365597.1 lcl|XCV3866

29

265

S=181 I=29 E=9.70037e-15

Zn-dependent dehydrogenase

XFF4834R

NP_644054.1 lcl|ybdR-XAC3747

29

265

S=175 I=29 E=4.65971e-14

Zn-dependent alcohol dehydrogenase

pubmed

1

369

S=1586 I=80 E=0

Formaldehyde dehydrogenase (Glutathione) EC=1.2.1.1 ; Metal-binding Oxidoreductase Zinc

Pubmed 8891129

 

prodomImg

pubmed

1

369

S=1574 I=79 E=0

Glutathione-dependent formaldehyde dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 11577159

 

prodomImg

pubmed

1

369

S=1557 I=78 E=5.42492e-180

Putative alcohol dehydrogenase class III ; Metal-binding Oxidoreductase Plasmid Zinc

Pubmed 18070959

 

prodomImg

pubmed

1

369

S=1557 I=78 E=5.52035e-180

Putative alcohol dehydrogenase ; Metal-binding Oxidoreductase Plasmid Zinc

Pubmed 16940067

 

prodomImg

pubmed

1

369

S=1557 I=78 E=5.76632e-180

Putative alcohol dehydrogenase class III ; Metal-binding Oxidoreductase Plasmid Zinc

Pubmed 18070959

 

prodomImg

pubmed

1

369

S=1537 I=77 E=1.50207e-177

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Plasmid Zinc

Pubmed 8052160

 

prodomImg

pubmed

1

369

S=1459 I=74 E=4.75368e-168

Putative formaldehyde dehydrogenase (Glutathione-dependent) ; Metal-binding Oxidoreductase Zinc

Pubmed 9098058,10591845

 

prodomImg

pubmed

22

369

S=1404 I=74 E=2.0643e-161

HI0185-like protein ; Metal-binding Oxidoreductase Zinc

Pubmed 16714566

 

prodomImg

pubmed

76

369

S=1304 I=80 E=3.02562e-149

S-(Hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase ; Plasmid

Pubmed 19258268

 

prodomImg

pubmed

1

369

S=1253 I=63 E=4.57499e-143

Alcohol dehydrogenase class-3 EC=1.1.1.1 EC=1.1.1.284 EC=1.1.1.- ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

Pubmed 8863743

 

prodomImg

sp_Pdown

sp|Q3Z550|FRMA_SHISS

1

369

S=1570 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

sp_Pdown

sp|B1J085|FRMA_ECOLC

1

369

S=1570 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

sp_Pdown

sp|A7ZX04|FRMA_ECOHS

1

369

S=1570 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

sp_Pdown

sp|Q8X5J4|FRMA_ECO57

1

369

S=1570 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

sp_Pdown

sp|A7ZIA4|FRMA_ECO24

1

369

S=1570 I=79 E=0

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

PD842149

259

306

S=252 I=98 E=4.75655e-23

PDA1H438

76

119

S=211 I=89 E=4.73673e-18

PD000463

326

369

S=174 I=70 E=1.45374e-13

PD499457

259

369

S=173 I=36 E=1.90488e-13

PDA1G6U7

294

324

S=156 I=94 E=2.42753e-11

PD270708

151

193

S=153 I=70 E=5.09352e-11

PDA6T5W3

192

242

S=137 I=51 E=4.16105e-09

PD886660

117

147

S=136 I=77 E=6.32347e-09

PDA6N361

219

258

S=131 I=65 E=2.25832e-08

PDA294E2

160

204

S=128 I=56 E=5.44781e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one IT5XZdjd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

366 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr07840950_0859525_f2_XFF4834R-XFF4834R_chr07430 XFF4834R_chr07430
XFF4834R_chr07420
XFF4834R_chr07420
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr07440
XFF4834R_chr07440
ID XFF4834R_chr07840950_0859525_f2_XFF4834R-XFF4834R_chr07430
AC XFF4834R_chr07430
LT XFF4834R_chr07430
OR XFF4834R_chr from 858950 to 859525 on strand +
DE glutathione-dependent formaldehyde-activating enzyme
IP Glutathione-dependent formaldehyde-activating, GFA
CL 1.1.5.7 Formaldehyde degradation
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: formaldehyde catabolic process (GO:0046294)
Molecular Function: carbon-sulfur lyase activity (GO:0016846)
Molecular Function: zinc ion binding (GO:0008270)
Molecular Function: S-(hydroxymethyl)glutathione synthase activity (GO:0051907)

Curated
PM
AN pathway of formaldehyde detoxification
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120326)
MW 20493.1 Da
SQ 191 aa
 
........10........20........30........40........50
| | | | |
MTNVSIHPSVDDGVARGGAENFQGGTLECHCANDKVTVEVSAQTAHNHAC
GCSKCWKPDGAKFSVVAVVPRDNVKVTAHQEKLKIVDESATIQRHACTGC
GVHLYGRIENKDHAFYGLDFVHTELSKQQGWSAPGFAAFVSSIIETGTPP
EQMDGVRARLTELGLPTYDCLSPALMDALSAHVARKKGLLH
Show or not Domain decomposition
 
XFF4834R

YP_362520.1 lcl|XCV0789

1

191

S=989 I=96 E=4.42659e-113

glutathione-dependent formaldehyde-activating enzyme

XFF4834R

NP_641088.1 lcl|XAC0735-XAC0735

1

191

S=982 I=96 E=3.5258e-112

glutathione-dependent formaldehyde-activating enzyme

XFF4834R

NP_638734.1 lcl|XCC3388

1

191

S=863 I=83 E=8.04793e-98

glutathione-dependent formaldehyde-activating enzyme

pubmed

4

190

S=664 I=64 E=4.45181e-72

Glutathione-dependent formaldehyde-activating enzyme EC=4.4.1.22 ; Lyase Metal-binding Plasmid Zinc

Pubmed 11481431

 

prodomImg

pubmed

2

190

S=639 I=62 E=4.25124e-69

Glutathione-dependent formaldehyde-activating enzyme EC=4.4.1.22 ; Lyase Metal-binding Zinc

Pubmed 8892832,11741920

 

prodomImg

sp_Pdown

sp|Q3BXJ3|GFA_XANC5

1

191

S=989 I=96 E=1.14722e-111

Glutathione-dependent formaldehyde-activating enzyme EC=4.4.1.22 ; Lyase Metal-binding Zinc

sp_Pdown

sp|Q8PPF1|GFA_XANAC

1

191

S=982 I=96 E=9.13767e-111

Glutathione-dependent formaldehyde-activating enzyme EC=4.4.1.22 ; Lyase Metal-binding Zinc

sp_Pdown

sp|B0RNW7|GFA_XANCB

1

191

S=867 I=84 E=6.48441e-97

Glutathione-dependent formaldehyde-activating enzyme EC=4.4.1.22 ; Lyase Metal-binding Zinc

sp_Pdown

sp|Q8P5F3|GFA_XANCP

1

191

S=863 I=83 E=2.08575e-96

Glutathione-dependent formaldehyde-activating enzyme EC=4.4.1.22 ; Lyase Metal-binding Zinc

sp_Pdown

sp|Q4UYL9|GFA_XANC8

1

191

S=863 I=83 E=2.08575e-96

Glutathione-dependent formaldehyde-activating enzyme EC=4.4.1.22 ; Lyase Metal-binding Zinc

Iprscan [G3DSA:3.90.1590.10]

4

191

-

Iprscan [MF_00723]

3

189

-

Iprscan IPR014185 [PIRSF033318]

6

191

S-(hydroxymethyl)glutathione synthase

Iprscan IPR006913 [PF04828]

48

123

Glutathione-dependent formaldehyde-activating, GFA

Iprscan IPR014185 [TIGR02820]

5

187

S-(hydroxymethyl)glutathione synthase

PD106017

29

188

S=680 I=76 E=6.26477e-75

PDA2T3F7

1

28

S=142 I=96 E=1.07353e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one HCIodPzm)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

14 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07430.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07430.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07430.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
frmB XFF4834R_chr07440
XFF4834R_chr07440
XFF4834R_chr07440
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0816
XFF4834R_chr_0816
ID frmB
AC XFF4834R_chr07440
LT XFF4834R_chr07440
OR XFF4834R_chr from 859584 to 860414 on strand +
DE probable S-formylglutathione hydrolase FrmB
IP Putative esterase; S-formylglutathione hydrolase
CL 1.1.5.7 Formaldehyde degradation
EC
GO InterPro
Cellular Component: cytoplasmic membrane-bounded vesicle (GO:0016023)
Molecular Function: S-formylglutathione hydrolase activity (GO:0018738)
Molecular Function: carboxylesterase activity (GO:0004091)

Curated
PM
AN according to GenProtEc
CC COG: [R] General function prediction only;
CC MODEL: acur
CC STATUS: curated by darrasse (20120326)
MW 29947.3 Da
SQ 276 aa
 
........10........20........30........40........50
| | | | |
MERIEHRACFGGWQDVYRHPSHTLNCSMQVGVYLPPQAADGPLPVLYWLS
GLTCTEQNFISKAGAQRYAAEHGVILVAPDTSPRGEDVADAGGYDIGKGA
GFYVDATQAPWAAHYRMYDYVVNELPALIEATFATTGARAISGHSMGGHG
ALTIALKNPGRYRSVSAFSPIVAPSQVPWGEKAFGQYLGNDRATWKAYDA
TALIADAQERLPLLIDQGDADEFLQNQLRTALFEDAAKAAGYPVTVRLQP
GYDHSYYFISSFIGEHIAHHAAALRG
XFF4834R

NP_641089.1 lcl|XAC0736-XAC0736

1

276

S=1439 I=98 E=2.43393e-167

esterase

XFF4834R

YP_362521.1 lcl|XCV0790

1

276

S=1421 I=96 E=3.02166e-165

carboxylesterase

XFF4834R

NP_638733.1 lcl|XCC3387

1

276

S=1360 I=92 E=9.17023e-158

esterase

XFF4834R

lcl|XALc_0863

1

275

S=1142 I=78 E=2.00129e-131

putative esterase protein

pubmed

1

274

S=1023 I=68 E=1.9934e-115

Putative esterase

Pubmed 15504844,15616297

 

prodomImg

pubmed

1

275

S=932 I=62 E=1.97517e-104

S-formylglutathione hydrolase ; Plasmid

Pubmed 19258268

 

prodomImg

pubmed

1

275

S=928 I=62 E=6.29809e-104

HI0184-like protein

Pubmed 16714566

 

prodomImg

pubmed

1

275

S=920 I=61 E=5.71735e-103

S-formylglutathione hydrolase EC=3.1.2.12 ; Serine esterase

Pubmed 10675023

 

prodomImg

pubmed

1

275

S=821 I=56 E=5.51421e-91

S-formylglutathione hydrolase EC=3.1.2.12 ; Cytoplasm Cytoplasmic vesicle Polymorphism Serine esterase

Pubmed 3462698,3164702

 

prodomImg

pubmed

1

275

S=796 I=54 E=6.72179e-88

S-formylglutathione hydrolase EC=3.1.2.12 ; Cytoplasm Cytoplasmic vesicle Polymorphism Serine esterase

Pubmed 11167536

 

prodomImg

pubmed

1

275

S=787 I=54 E=8.35189e-87

S-formylglutathione hydrolase EC=3.1.2.12 ; Serine esterase

Pubmed 11888210

 

prodomImg

pubmed

2

274

S=732 I=52 E=3.88884e-80

S-formylglutathione hydrolase EC=3.1.2.12 ; Serine esterase

Pubmed 8892832

 

prodomImg

pubmed

1

274

S=572 I=44 E=9.72938e-61

S-formylglutathione hydrolase EC=3.1.2.12 ; Cytoplasm Serine esterase

Pubmed 7762302

 

prodomImg

pubmed

11

275

S=517 I=41 E=4.94294e-54

Formaldehyde dehydrogenase/S-formylglutathione hydrolase fusion protein

Pubmed 15858209

 

prodomImg

sp_Pdown

sp|Q8FKG2|SFGH1_ECOL6

1

275

S=935 I=61 E=6.26509e-105

S-formylglutathione hydrolase frmB EC=3.1.2.12 ; Serine esterase

sp_Pdown

sp|Q3Z551|SFGH1_SHISS

1

275

S=934 I=61 E=8.57514e-105

S-formylglutathione hydrolase frmB EC=3.1.2.12 ; Serine esterase

sp_Pdown

sp|A7ZIA3|SFGH1_ECO24

1

275

S=934 I=61 E=8.57514e-105

S-formylglutathione hydrolase frmB EC=3.1.2.12 ; Serine esterase

sp_Pdown

sp|Q0TKS8|SFGH1_ECOL5

1

275

S=931 I=61 E=2.06861e-104

S-formylglutathione hydrolase frmB EC=3.1.2.12 ; Serine esterase

sp_Pdown

sp|Q1RFI8|SFGH1_ECOUT

1

275

S=931 I=61 E=2.19879e-104

S-formylglutathione hydrolase frmB EC=3.1.2.12 ; Serine esterase

PDA1F348

60

120

S=227 I=68 E=4.74541e-20

PD007616

171

243

S=209 I=51 E=8.27722e-18

PDA1O9E0

1

27

S=140 I=89 E=1.74029e-09

PD017485

139

175

S=134 I=70 E=9.52777e-09

PD687612

28

58

S=121 I=66 E=3.0621e-07

PDA6T5P0

1

60

S=114 I=39 E=2.17763e-06

PD861687

245

274

S=111 I=67 E=6.30866e-06

PDA2Y5S2

1

59

S=108 I=37 E=1.26724e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VtaKRLNn)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

16 hits
swiss-prot

Swiss-Prot ncbi-blastp

36 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07440.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07440.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBqeJXTS/XFF4834R_chr07440.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.