Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr37510XFF4834R_chr40630032_4338129_f1_XFF4834R-XFF4834R_chr37510XFF4834R_chr37510putative mandelate racemase/muconate lactonizing enzyme
  2. XFF4834R_chr40580XFF4834R_chr_4692124_4693446_f1_XFF4834R-XFF4834R_chr40580XFF4834R_chr40580putative mandelate racemase/muconate lactonizing enzyme

XFF4834R_chr40630032_4338129_f1_XFF4834R-XFF4834R_chr37510 XFF4834R_chr37510
XFF4834R_chr37500
XFF4834R_chr37500
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr37520
XFF4834R_chr37520
ID XFF4834R_chr40630032_4338129_f1_XFF4834R-XFF4834R_chr37510
AC XFF4834R_chr37510
LT XFF4834R_chr37510
OR XFF4834R_chr from 4337032 to 4338129 on strand +
DE putative mandelate racemase/muconate lactonizing enzyme
IP O-succinylbenzoic acid (OSB) synthetase, low GC Gram-positive bacteria/archaea; Mandelate racemase/muconate lactonizing enzyme, conserved site
CL 1.1.5.5 Mandelate catabolism GO:0019596
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: cellular amino acid catabolic process (GO:0009063)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN also 41 % identity (on 90 and 97% of sequences) with YkfB (L-Ala-D/L-Glu epimerase) of Bacillus halodurans
CC COG: [MR] Cell wall/membrane/envelope biogenesis;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100823)
MW 38391.9 Da
SQ 365 aa
 
........10........20........30........40........50
| | | | |
MKITGFRLGMVRVPLKTPFKTAVRTVQAIEDVVVLLQTDSGHIGYGAAPA
TAPITGDTHGSIIAAIQHCIGPKLIGQDVADLNRLCGLVQHALERNTSAK
AAVEIALYDLWAQGFGAPLYQLLGGGTPRVTTDITISADTIATMVAQAQA
ALAHGYRALKIKVGKDIESDVERVTAIHAAVAGRASLRLDANQGWTPKQA
VRTMRTLEDGGIALELLEQPVKAADLDGLAFVTARIDTPVMADESVFSPT
QVIALIQRRAADIINIKLMKTGGLSNAIRIADIAGLYGLPCMIGCMIESS
ISVSAAVHLAVAKADSITLADLDAPALGQFDPTEGGVRFDEAQIHIDDSP
GLGIRRIHGLELLPA
XFF4834R

XFF4834R_chr40580 lcl|XFF4834R_chr_4692124_4693446_f1_XFF4834R-XFF4834R_chr40580

159

289

S=123 I=30 E=2.36936e-08

XFF4834R

NP_644168.1 lcl|tcbD-XAC3862

1

365

S=1631 I=91 E=0

chloromuconate cycloisomerase

XFF4834R

YP_365711.1 lcl|tcbD-XCV3980

1

365

S=1589 I=88 E=0

putative chloromuconate cycloisomerase

XFF4834R

NP_639152.1 lcl|tcbD-XCC3807

1

364

S=1477 I=83 E=8.03877e-172

chloromuconate cycloisomerase

XFF4834R

lcl|XALc_0421

1

364

S=1246 I=67 E=8.34719e-144

putative chloromuconate cycloisomerase protein

XFF4834R

NP_639408.1 lcl|XCC4069

159

289

S=132 I=30 E=6.42996e-09

RTS beta protein

XFF4834R

lcl|XALc_0448

159

289

S=131 I=30 E=8.87788e-09

putative mandelate racemase/muconate lactonizing enzyme protein

XFF4834R

NP_644487.1 lcl|XAC4188-XAC4188

159

289

S=118 I=28 E=3.3673e-07

RTS beta protein

XFF4834R

YP_366018.1 lcl|XCV4287

159

289

S=118 I=28 E=4.07929e-07

putative mandelate racemase/muconate lactonizing enzyme

pubmed

1

359

S=784 I=46 E=2.91672e-86

L-Ala-D/L-Glu epimerase EC=5.1.1.n1 ; Cell wall biogenesis/degradation Isomerase Magnesium Metal-binding

Pubmed 11747447

 

prodomImg

pubmed

1

354

S=763 I=46 E=1.09577e-83

L-Ala-D/L-Glu epimerase EC=5.1.1.n1 ; Cell wall biogenesis/degradation Isomerase Magnesium Metal-binding

Pubmed 11747447

 

prodomImg

pubmed

1

354

S=644 I=40 E=3.08334e-69

Mandelate racemase-like protein ; Metal-binding

Pubmed 17113999,17220970

 

prodomImg

pubmed

23

350

S=542 I=41 E=6.18552e-57

YkfB ; Metal-binding

Pubmed 10086841

 

prodomImg

pubmed

2

324

S=385 I=32 E=6.08815e-38

L-Ala-D/L-Glu epimerase EC=5.1.1.n1 ; Cell wall biogenesis/degradation Isomerase Magnesium Metal-binding

Pubmed 11747447

 

prodomImg

sp_Pdown

sp|Q97MK4|AEEP_CLOAB

1

359

S=784 I=46 E=1.98503e-86

L-Ala-D/L-Glu epimerase EC=5.1.1.n1 ; Cell wall biogenesis/degradation Isomerase Magnesium Metal-binding

sp_Pdown

sp|O34508|AEEP_BACSU

1

354

S=763 I=46 E=7.45745e-84

L-Ala-D/L-Glu epimerase EC=5.1.1.n1 ; Cell wall biogenesis/degradation Isomerase Magnesium Metal-binding

sp_Pdown

sp|Q9WXM1|AEEP_THEMA

2

324

S=385 I=32 E=4.1434e-38

L-Ala-D/L-Glu epimerase EC=5.1.1.n1 ; Cell wall biogenesis/degradation Isomerase Magnesium Metal-binding

sp_Pdown

sp|P95608|CATB_RHOOP

1

355

S=363 I=29 E=2.42825e-35

Muconate cycloisomerase 1 EC=5.5.1.1 ; Aromatic hydrocarbons catabolism Manganese Metal-binding

sp_Pdown

sp|Q9RNZ9|TFDD_DELAC

1

358

S=331 I=27 E=1.64906e-31

Chloromuconate cycloisomerase EC=5.5.1.7 ; Aromatic hydrocarbons catabolism Manganese Metal-binding

Iprscan [G3DSA:3.20.20.120]

107

355

-

Iprscan [PTHR13794:SF12]

81

363

-

Iprscan IPR001354 [PTHR13794]

81

363

Mandelate racemase/muconate lactonizing enzyme

Iprscan IPR013342 [PF01188]

143

239

Mandelate racemase/muconate lactonizing enzyme, C-terminal

Iprscan IPR013341 [PF02746]

11

124

Mandelate racemase/muconate lactonizing enzyme, N-terminal

Iprscan IPR018110 [PS00908]

99

124

Mandelate racemase/muconate lactonizing enzyme, conserved site

Iprscan [seg]

131

158

-

PD486113

62

113

S=170 I=63 E=4.37608e-13

PDA0T1Q3

1

125

S=142 I=29 E=9.56715e-10

PD003216

159

265

S=129 I=36 E=3.41389e-08

PDA5P0H1

1

125

S=117 I=32 E=1.15611e-06

PD528176

259

354

S=115 I=31 E=1.74166e-06

PD338790

266

354

S=113 I=40 E=3.6544e-06

Iprscan [SSF51604]

112

355

-

Iprscan [SSF54826]

1

125

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ADLoMu0j)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

72 hits
swiss-prot

Swiss-Prot ncbi-blastp

32 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXhcol1/XFF4834R_chr37510.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXhcol1/XFF4834R_chr37510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXhcol1/XFF4834R_chr37510.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXhcol1/XFF4834R_chr37510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4692124_4693446_f1_XFF4834R-XFF4834R_chr40580 XFF4834R_chr40580
XFF4834R_chr40570
XFF4834R_chr40570
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40590
XFF4834R_chr40590
ID XFF4834R_chr_4692124_4693446_f1_XFF4834R-XFF4834R_chr40580
AC XFF4834R_chr40580
LT XFF4834R_chr40580
OR XFF4834R_chr from 4692124 to 4693446 on strand +
DE putative mandelate racemase/muconate lactonizing enzyme
IP Muconate/chloromuconate cycloisomerase; Mandelate racemase
CL 1.1.5.5 Mandelate catabolism GO:0019596
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [MR] Cell wall/membrane/envelope biogenesis;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100824)
MW 48040.3 Da
SQ 440 aa
 
........10........20........30........40........50
| | | | |
MSTIVALDTHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDAADDLAGY
GLVFTIGRGNDVQTAAVAALAEHVVGLRVEDVIADLGAFARRLTNDSQLR
WLGPEKGVMHMAIGAVINAAWDLAARVAKKPLWRFIAELTPEQLVDTIDF
RYLTDALTRDEALAILRAAQPQRAQRIAMLIEQGYPAYTTSPGWLGYSDE
KLVRLAKEAVADGFRTIKLKVGANVRDDVRRCRLARAAIGPDIAMAVDAN
QRWDVGPAIDWMRQLAEFDIAWIEEPTSPDDVLGHAAIRQGIAPVPVSTG
EHTQNRVVFKQLLQAGAVDLIQIDAARVGGVNENLAILLLAAKFNVRVFP
HAGGVGLCELVQHLAMADFVAITGKMEDRAIEFVDHLHQHFLDPVRIRHG
RYLAPEAAGFSAEMHAASIAEFSYPGGRFWVEDLAASAKT
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr37510 lcl|XFF4834R_chr40630032_4338129_f1_XFF4834R-XFF4834R_chr37510

180

346

S=158 I=30 E=1.88304e-12

L-Ala-D/L-Glu epimerase

XFF4834R

XFF4834R_chr27470 lcl|dgoD-XFF4834R_chr27470

236

381

S=136 I=27 E=8.95198e-10

galactonate dehydratase

XFF4834R

YP_366018.1 lcl|XCV4287

1

440

S=2101 I=94 E=0

putative mandelate racemase/muconate lactonizing enzyme

XFF4834R

NP_639408.1 lcl|XCC4069

1

437

S=2037 I=91 E=0

RTS beta protein

XFF4834R

NP_644487.1 lcl|XAC4188-XAC4188

26

439

S=1979 I=94 E=0

RTS beta protein

XFF4834R

lcl|XALc_0448

1

437

S=1872 I=84 E=0

putative mandelate racemase/muconate lactonizing enzyme protein

XFF4834R

YP_365711.1 lcl|tcbD-XCV3980

180

346

S=162 I=30 E=2.03704e-12

putative chloromuconate cycloisomerase

XFF4834R

lcl|dgoD-XALc_1189

212

381

S=161 I=30 E=2.98955e-12

probable galactonate dehydratase protein

XFF4834R

NP_644168.1 lcl|tcbD-XAC3862

180

346

S=160 I=30 E=3.75021e-12

chloromuconate cycloisomerase

XFF4834R

NP_639152.1 lcl|tcbD-XCC3807

180

346

S=149 I=29 E=7.86223e-11

chloromuconate cycloisomerase

XFF4834R

lcl|XALc_0421

180

346

S=145 I=28 E=2.55108e-10

putative chloromuconate cycloisomerase protein

XFF4834R

NP_642093.1 lcl|dgoA-XAC1765

236

381

S=136 I=27 E=3.28224e-09

4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase

XFF4834R

YP_363527.1 lcl|dgoD-XCV1796

236

381

S=136 I=27 E=3.36922e-09

galactonate dehydratase

XFF4834R

NP_637113.1 lcl|dgoA-XCC1746

236

381

S=131 I=26 E=1.09322e-08

4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase

pubmed

1

432

S=1507 I=66 E=1.10643e-173

Putative mandelate racemase/muconate lactonizing enzyme

Pubmed 12730200

 

prodomImg

pubmed

4

437

S=1237 I=50 E=5.04117e-141

Mitochondrial enolase superfamily member 1 EC=5.-.-.- ; Alternative splicing Isomerase Magnesium Metal-binding Mitochondrion Phosphoprotein P

Pubmed 8493092,8764108

 

prodomImg

pubmed

22

437

S=1152 I=49 E=9.04455e-131

Putative uncharacterized protein ENOSF1

Pubmed 16177791

 

prodomImg

pubmed

3

435

S=1139 I=50 E=4.1198e-129

L-galactonate dehydratase

Pubmed 16879654

 

prodomImg

pubmed

4

273

S=746 I=61 E=1.62646e-81

Mandelate racemase ; Metal-binding

Pubmed 19897889

 

prodomImg

sp_Pdown

sp|Q2KIA9|ENOF1_BOVIN

7

439

S=1282 I=54 E=1.10846e-146

Mitochondrial enolase superfamily member 1 EC=5.-.-.- ; Isomerase Magnesium Metal-binding Mitochondrion Phosphoprotein Ubl conjugation

sp_Pdown

sp|Q6INX4|ENOF1_XENLA

4

430

S=1276 I=53 E=6.62149e-146

Mitochondrial enolase superfamily member 1 EC=5.-.-.- ; Isomerase Magnesium Metal-binding Mitochondrion

sp_Pdown

sp|Q7L5Y1|ENOF1_HUMAN

4

437

S=1237 I=50 E=3.4289e-141

Mitochondrial enolase superfamily member 1 EC=5.-.-.- ; Alternative splicing Isomerase Magnesium Metal-binding Mitochondrion Phosphoprotein P

sp_Pdown

sp|Q5RAT4|ENOF1_PONAB

4

437

S=1230 I=50 E=2.48137e-140

Mitochondrial enolase superfamily member 1 EC=5.-.-.- ; Isomerase Magnesium Metal-binding Mitochondrion Phosphoprotein Ubl conjugation

sp_Pdown

sp|O06741|YITF_BACSU

185

429

S=252 I=29 E=7.16969e-22

Putative isomerase yitF EC=5.-.-.- ; Magnesium Metal-binding

Iprscan [G3DSA:3.20.20.120]

132

435

-

Iprscan IPR015654 [PTHR13794:SF2]

94

434

Mandelate racemase

Iprscan IPR001354 [PTHR13794]

94

434

Mandelate racemase/muconate lactonizing enzyme

Iprscan IPR013342 [PF01188]

200

290

Mandelate racemase/muconate lactonizing enzyme, C-terminal

Iprscan IPR013341 [PF02746]

34

136

Mandelate racemase/muconate lactonizing enzyme, N-terminal

Iprscan [seg]

162

178

-

PDA1G4P6

329

424

S=353 I=63 E=3.37742e-35

PD041688

79

161

S=297 I=64 E=2.00744e-28

PD003216

198

328

S=229 I=43 E=3.42377e-20

PDA5P0G4

10

98

S=169 I=37 E=5.64395e-13

PD029163

26

63

S=163 I=76 E=3.28441e-12

PD602887

63

95

S=141 I=88 E=1.39409e-09

PDA838C9

1

25

S=126 I=100 E=8.39361e-08

PDA2C5Z4

1

25

S=116 I=88 E=1.41507e-06

PDA838D5

4

25

S=104 I=86 E=4.31605e-05

Iprscan [SSF51604]

181

424

-

Iprscan [SSF54826]

1

136

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one SiPRnLCR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

35 hits
swiss-prot

Swiss-Prot ncbi-blastp

104 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXhcol1/XFF4834R_chr40580.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXhcol1/XFF4834R_chr40580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXhcol1/XFF4834R_chr40580.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBXhcol1/XFF4834R_chr40580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.