Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr03500pcaFXFF4834R_chr03500predicted beta-ketoadipyl CoA thiolase
  2. XFF4834R_chr03510pcaHXFF4834R_chr03510probable protocatechuate 3,4-dioxygenase beta chain
  3. XFF4834R_chr03520pcaGXFF4834R_chr03520probable protocatechuate 3,4-dioxygenase alpha chain
  4. XFF4834R_chr03530pcaBXFF4834R_chr03530probable 3-carboxy-cis,cis-muconate cycloisomerase protein
  5. XFF4834R_chr03550pcaCXFF4834R_chr03550probable 4-carboxymuconolactone decarboxylase

pcaF XFF4834R_chr03500
XFF4834R_chr03490
XFF4834R_chr03490
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03510
XFF4834R_chr03510
ID pcaF
AC XFF4834R_chr03500
LT XFF4834R_chr03500
OR XFF4834R_chr from 402359 to 403567 on strand +
DE predicted beta-ketoadipyl CoA thiolase
IP Thiolase; Thiolase-like
CL 1.1.5.4 Beta-ketoadipate pathway GO:0042952
EC
GO InterPro
Biological Process: protocatechuate catabolic process (GO:0019619)
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN according to Acinetobacter annotation
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 41638 Da
SQ 402 aa
 
........10........20........30........40........50
| | | | |
MSEVYLVDGIRTPIGRYGGALSSVRADDLGAVPIAALLARQPQLEPAAID
DVYLGCANQAGEDNRNVARMSLLLAGLPPSVPGSTLNRLCGSGLDAIGTV
ARGMRAGELDLAIAGGVESMSRAPWVMGKADSAFARTQQLEDTTMGWRFI
NPRLQAVYGTELMGETAENVAQRYAIARQDQDAFALRSQQRAAAAQAAGF
FDGEITPVAVAARKGGDASTVEHDEAPRPDTTAEMLAKLKPVFRQPGTVT
AGNASGLNDGAAALLLASAQAVQTHRLTPRARVLGFASAGVEPAYMGIGP
VPATERLLARLNLRIAQFDAIELNEAFAAQALACTRTLGLADDAAHVNAN
GGAIALGHPLGMSGARLALTLLRQLEAGNGRLGLASMCIGVGQGVALAIE
RL
XFF4834R

XFF4834R_chr21150 lcl|XFF4834R_chr23020837_2455042_r3_XFF4834R-XFF4834R_chr21150

1

402

S=614 I=39 E=7.64398e-68

XFF4834R

XFF4834R_chr31520 lcl|XFF4834R_chr34100398_3622573_f2_XFF4834R-XFF4834R_chr31520

1

402

S=491 I=35 E=6.07039e-53

predicted acyltransferase

XFF4834R

XFF4834R_chr01840 lcl|fadI-XFF4834R_chr01840

4

401

S=308 I=29 E=1.16627e-30

beta-ketoacyl-CoA thiolase, anaerobic, subunit

XFF4834R

YP_362111.1 lcl|pcaF-XCV0380

1

402

S=1763 I=87 E=0

beta-ketoadipyl CoA thiolase

XFF4834R

NP_640722.1 lcl|pcaF-XAC0366

1

402

S=1738 I=86 E=0

beta-ketoadipyl CoA thiolase

XFF4834R

NP_635761.1 lcl|pcaF-XCC0366

1

402

S=1570 I=77 E=0

beta-ketoadipyl CoA thiolase

XFF4834R

lcl|pcaF-XALc_3031

1

402

S=1426 I=71 E=1.3023e-165

probable beta-ketoadipyl coa thiolase protein

XFF4834R

lcl|fadA-XALc_1595

1

402

S=634 I=40 E=1.22311e-69

probable acetyl-coa c-acyltransferase protein

XFF4834R

NP_642338.1 lcl|fadA-XAC2012

1

402

S=619 I=40 E=7.89615e-68

acetyl-CoA acetyltransferase

XFF4834R

YP_363794.1 lcl|fadA-XCV2063

1

402

S=618 I=40 E=1.18955e-67

acetyl-CoA acetyltransferase

XFF4834R

NP_637343.1 lcl|fadA-XCC1978

1

402

S=612 I=39 E=5.96877e-67

acetyl-CoA acetyltransferase

XFF4834R

NP_641683.1 lcl|atoB-XAC1348

1

402

S=495 I=35 E=7.73016e-53

acetoacetyl-CoA thiolase

XFF4834R

YP_363132.1 lcl|thlA-XCV1401

1

402

S=492 I=35 E=2.05247e-52

acetyl-CoA C-acetyltransferase

XFF4834R

lcl|atoB-XALc_2525

1

400

S=470 I=34 E=8.63625e-50

probable acetyl-coa c-acetyltransferase protein

XFF4834R

NP_636671.1 lcl|atoB-XCC1297

1

402

S=460 I=32 E=1.63071e-48

acetoacetyl-CoA thiolase

XFF4834R

NP_635589.1 lcl|yfcY-XCC0194

4

401

S=315 I=29 E=6.05007e-31

acetyl-CoA acetyltransferase

XFF4834R

NP_640569.1 lcl|yfcY-XAC0213

4

401

S=308 I=29 E=3.74231e-30

acetyl-CoA acetyltransferase

XFF4834R

YP_361929.1 lcl|XCV0198

4

401

S=308 I=29 E=4.26518e-30

acetyl-CoA acetyltransferase

XFF4834R

lcl|XALc_3086

4

401

S=307 I=29 E=5.25792e-30

putative acetyl-coa c-acyltransferase protein

pubmed

3

402

S=1198 I=60 E=2.29949e-136

Beta-ketoadipyl-CoA thiolase EC=2.3.1.174 ; Acyltransferase Aromatic hydrocarbons catabolism

Pubmed 11741863,11741862

 

prodomImg

pubmed

3

402

S=1166 I=59 E=1.58909e-132

3-ketoadipyl-CoA thiolase

Pubmed 12399500

 

prodomImg

pubmed

1

402

S=1162 I=58 E=5.33915e-132

Beta-ketoadipyl-CoA thiolase EC=2.3.1.174 ; Acyltransferase Aromatic hydrocarbons catabolism

Pubmed 7961399

 

prodomImg

pubmed

1

402

S=1157 I=58 E=2.15433e-131

Putative ketothiolase

Pubmed 9495743

 

prodomImg

pubmed

1

401

S=1155 I=58 E=4.36536e-131

PaaE

Pubmed 17377771

 

prodomImg

sp_Pdown

sp|Q9I6R0|PCAF_PSEAE

3

402

S=1222 I=61 E=1.88152e-139

Beta-ketoadipyl-CoA thiolase EC=2.3.1.174 ; Acyltransferase Aromatic hydrocarbons catabolism

sp_Pdown

sp|Q8VPF1|PCAF_PSESB

3

402

S=1198 I=60 E=1.57649e-136

Beta-ketoadipyl-CoA thiolase EC=2.3.1.174 ; Acyltransferase Aromatic hydrocarbons catabolism

sp_Pdown

sp|Q51956|PCAF_PSEPU

1

402

S=1162 I=58 E=3.66042e-132

Beta-ketoadipyl-CoA thiolase EC=2.3.1.174 ; Acyltransferase Aromatic hydrocarbons catabolism

sp_Pdown

sp|Q43974|PCAF_ACIAD

1

402

S=1148 I=56 E=2.14698e-130

Beta-ketoadipyl-CoA thiolase EC=2.3.1.174 ; Acyltransferase Aromatic hydrocarbons catabolism

sp_Pdown

sp|Q43935|CATF_ACIAD

1

402

S=1145 I=56 E=4.3127e-130

Beta-ketoadipyl-CoA thiolase EC=2.3.1.174 ; Acyltransferase Aromatic hydrocarbons catabolism

Iprscan IPR016038 [G3DSA:3.40.47.10]

1

283

Thiolase-like, subgroup

Iprscan IPR002155 [PIRSF000429]

1

402

Thiolase

Iprscan [PTHR18919:SF8]

66

402

-

Iprscan IPR002155 [PTHR18919]

66

402

Thiolase

Iprscan IPR020616 [PF00108]

1

269

Thiolase, N-terminal

Iprscan IPR020617 [PF02803]

278

401

Thiolase, C-terminal

Iprscan IPR012793 [TIGR02430]

2

402

Beta-ketoadipyl CoA thiolase

Iprscan IPR002155 [TIGR01930]

6

400

Thiolase

Iprscan IPR020615 [PS00098]

86

104

Thiolase, acyl-enzyme intermediate active site

Iprscan IPR020610 [PS00099]

383

396

Thiolase, active site

Iprscan IPR020613 [PS00737]

348

364

Thiolase, conserved site

Iprscan [seg]

183

201

-

Iprscan [seg]

251

271

-

PDA8Z0A6

44

246

S=189 I=28 E=1.98801e-15

PD858891

347

402

S=186 I=68 E=4.75412e-15

PD985894

79

400

S=185 I=27 E=5.96374e-15

PD747639

11

127

S=160 I=34 E=6.00091e-12

PDA70288

129

161

S=148 I=73 E=1.83032e-10

PD000145

73

136

S=142 I=50 E=1.10293e-09

PD859032

296

348

S=139 I=58 E=2.29411e-09

PD922406

303

400

S=136 I=32 E=5.93394e-09

PDA8G9F2

4

124

S=134 I=36 E=9.7538e-09

PD983013

204

245

S=133 I=57 E=1.08296e-08

Iprscan IPR016039 [SSF53901]

1

275

Thiolase-like

Iprscan IPR016039 [SSF53901]

277

402

Thiolase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one WnfjJGRu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

235 hits
swiss-prot

Swiss-Prot ncbi-blastp

284 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03500.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03500.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pcaH XFF4834R_chr03510
XFF4834R_chr03500
XFF4834R_chr03500
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03520
XFF4834R_chr03520
ID pcaH
AC XFF4834R_chr03510
LT XFF4834R_chr03510
OR XFF4834R_chr from 403646 to 404383 on strand +
DE probable protocatechuate 3,4-dioxygenase beta chain
IP Intradiol ring-cleavage dioxygenase, C-terminal
CL 1.1.5.4 Beta-ketoadipate pathway GO:0042952
EC
GO InterPro
4-dioxygenase activity (GO:0018578)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: protocatechuate catabolic process (GO:0019619)
Biological Process: cellular aromatic compound metabolic process (GO:0006725)
Molecular Function: ferric iron binding (GO:0008199)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: iron ion binding (GO:0005506)
incorporation of two atoms of oxygen (GO:0016702)

Curated
PM
AN according to Acinetobacter annotation
CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 27249.4 Da
SQ 245 aa
 
........10........20........30........40........50
| | | | |
MRDPTAEQPAIAAEPLLGYRRSRPGTQPAYLHPAYASTTLRGPTRAPIDL
PVTLSEVTGPRLDRLTLGAHAADLTAGFSGAPLGERIIVSGRVLDENGRP
VRNSIVEVWQCNAAGRYQHAGDQHDAPLDPNFRGTGQVLTDAHGRYSFKT
IKPGAYPWRNHYNAWRPAHIHFSLHGDGIGQRLVTQMYFPGDPLLAHDPI
YNCVDDALARERMVSSFDWENAVSEYALAYRFDIVLRGRKQTVWE
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr03520 lcl|XFF4834R_chr03660388_0404948_f3_XFF4834R-XFF4834R_chr03520

84

244

S=233 I=37 E=6.21323e-22

XFF4834R

XFF4834R_chr03520 lcl|XFF4834R_chr03660388_0404948_f3_XFF4834R-XFF4834R_chr03520

84

244

S=233 I=37 E=6.21323e-22

pubmed

26

245

S=668 I=61 E=1.74368e-72

Protocatechuate 3,4-dioxygenase beta subunit

Pubmed 12127980

 

prodomImg

pubmed

26

245

S=664 I=61 E=6.1732e-72

Protocatechuate 3,4-dioxygenase beta chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Metal-binding Oxidoreductase

Pubmed 2808303

 

prodomImg

pubmed

26

245

S=650 I=60 E=3.06806e-70

Protocatechuate 3,4-dioxygenase beta-subunit

Pubmed 9022300

 

prodomImg

pubmed

26

245

S=603 I=54 E=1.42976e-64

Protocatechuate 3,4-dioxygenase bata subunit ; Plasmid

Pubmed 12658514,15317800

 

prodomImg

pubmed

31

245

S=601 I=53 E=2.24989e-64

Protocatechuate dioxygenase beta subunit EC=1.13.11.3 ; Oxidoreductase

Pubmed 9495744

 

prodomImg

pubmed

27

245

S=597 I=51 E=7.55936e-64

Protocatechuate 3,4-dioxygenase beta chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Metal-binding Oxidoreductase

Pubmed 8407791,115853

 

prodomImg

pubmed

35

238

S=590 I=53 E=4.51563e-63

Protocatechuate 3,4-dioxygenase beta subunit EC=1.13.11.3 ; Oxidoreductase

Pubmed 10742233

 

prodomImg

pubmed

27

245

S=587 I=51 E=1.16801e-62

Protocatechuate-3,4-dioxygenase, beta subunit EC=1.13.11.3 ; Oxidoreductase Plasmid

Pubmed 10565539

 

prodomImg

pubmed

27

245

S=586 I=49 E=1.50403e-62

Protocatechuate 3,4-dioxygenase beta subunit EC=1.13.11.3 ; Oxidoreductase

Pubmed 10049847

 

prodomImg

pubmed

27

245

S=584 I=50 E=3.02118e-62

B-subunit of protocatechuate 3,4-dioxygenase

Pubmed 11390692

 

prodomImg

sp_Pdown

sp|P15110|PCXB_BURCE

26

245

S=664 I=61 E=4.25932e-72

Protocatechuate 3,4-dioxygenase beta chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Metal-binding Oxidoreductase

sp_Pdown

sp|P00437|PCXB_PSEPU

27

245

S=597 I=51 E=5.21573e-64

Protocatechuate 3,4-dioxygenase beta chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Metal-binding Oxidoreductase

sp_Pdown

sp|P20372|PCXB_ACIAD

28

245

S=550 I=49 E=2.45188e-58

Protocatechuate 3,4-dioxygenase beta chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Metal-binding Oxidoreductase

sp_Pdown

sp|P20371|PCXA_ACIAD

84

244

S=224 I=34 E=8.93108e-19

Protocatechuate 3,4-dioxygenase alpha chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Oxidoreductase

sp_Pdown

sp|P86029|HQD2_CANAL

82

236

S=193 I=33 E=4.27944e-15

Catechol 1,2-dioxygenase EC=1.13.11.1 ; Aromatic hydrocarbons catabolism Iron Metal-binding Oxidoreductase

PD002260

84

167

S=277 I=63 E=4.35869e-26

PDA1F8E7

178

244

S=148 I=47 E=1.69199e-10

PDA1H362

18

75

S=146 I=62 E=3.4285e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one AVcqBfIY)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

137 hits
swiss-prot

Swiss-Prot ncbi-blastp

16 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03510.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03510.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03510.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pcaG XFF4834R_chr03520
XFF4834R_chr03510
XFF4834R_chr03510
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03530
XFF4834R_chr03530
ID pcaG
AC XFF4834R_chr03520
LT XFF4834R_chr03520
OR XFF4834R_chr from 404388 to 404948 on strand +
DE probable protocatechuate 3,4-dioxygenase alpha chain
IP Intradiol ring-cleavage dioxygenase, C-terminal
CL 1.1.5.4 Beta-ketoadipate pathway GO:0042952
EC
GO InterPro
4-dioxygenase activity (GO:0018578)
Biological Process: cellular aromatic compound metabolic process (GO:0006725)
Biological Process: aromatic compound catabolic process (GO:0019439)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: ferric iron binding (GO:0008199)
incorporation of two atoms of oxygen (GO:0016702)

Curated
PM
AN according to Acinetobacter annotation
CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 19963.3 Da
SQ 186 aa
 
........10........20........30........40........50
| | | | |
MSLHATPSQTVGPYYRLGLEPLYRQQIAPAHAAGAHVQISGRIFDGAGAP
VADAVLEVWQADAGGIYAHAADGRWEAHDPSFDGWGRVPTDAHGRFSFST
IKPGRVAGPDGKQQAAHLTVLVFMRGLLRGVSTRLYFADDPQLGSDPILA
LVPAERRATLLAQPHAGGAYAWDIHMQGDAETVFFR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr03510 lcl|XFF4834R_chr03650646_0404383_f2_XFF4834R-XFF4834R_chr03510

34

184

S=233 I=37 E=4.24722e-22

XFF4834R

XFF4834R_chr03510 lcl|XFF4834R_chr03650646_0404383_f2_XFF4834R-XFF4834R_chr03510

34

184

S=233 I=37 E=4.24722e-22

pubmed

3

185

S=389 I=39 E=7.98888e-39

Protocatechuate 3,4-dioxygenase alpha-chain

Pubmed 15066829

 

prodomImg

pubmed

3

185

S=376 I=46 E=2.97773e-37

Putative protocatechuate 3,4 dioxygenase alpha subunit EC=1.13.11.3 ; Oxidoreductase

Pubmed 15006791

 

prodomImg

pubmed

3

185

S=355 I=43 E=9.07471e-35

Putative protocatechuate 3,4 dioxygenase alpha subunit EC=1.13.11.3 ; Oxidoreductase

Pubmed 15006791

 

prodomImg

pubmed

2

185

S=354 I=40 E=1.30878e-34

Protocatechuate 3,4-dioxygenase alpha chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Oxidoreductase

Pubmed 2298704,8063101

 

prodomImg

pubmed

3

185

S=350 I=40 E=3.41493e-34

Protocatechuate 3,4-dioxygenase type I alpha subunit PcaG-I

Pubmed 11029433

 

prodomImg

pubmed

3

185

S=350 I=43 E=3.475e-34

Protocatechuate 3,4-dioxygenase alpha subunit

Pubmed 11055908,15006791

 

prodomImg

pubmed

3

185

S=348 I=40 E=5.96647e-34

Protocatechuate 3,4-dioxygenase alpha chain EC=1.13.11.3 ; Oxidoreductase

Pubmed 11029436

 

prodomImg

pubmed

6

185

S=344 I=43 E=2.07581e-33

Protocatechuate 3,4-dioxygenase alpha subunit EC=1.13.11.3 ; Oxidoreductase

Pubmed 11055908,15006791

 

prodomImg

pubmed

3

185

S=343 I=39 E=2.51473e-33

Protocatechuate 3,4-dioxygenase alpha chain Putative protocatechuate 3,4 dioxygenase alpha subunit EC=1.13.11.3 ; Oxidoreductase

Pubmed 15006791

 

prodomImg

pubmed

3

185

S=343 I=40 E=3.07313e-33

Putative protocatechuate 3,4 dioxygenase alpha subunit EC=1.13.11.3 ; Oxidoreductase

Pubmed 15006791

 

prodomImg

sp_Pdown

sp|P20371|PCXA_ACIAD

2

185

S=354 I=40 E=9.08383e-35

Protocatechuate 3,4-dioxygenase alpha chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Oxidoreductase

sp_Pdown

sp|P15109|PCXA_BURCE

2

185

S=326 I=44 E=2.38497e-31

Protocatechuate 3,4-dioxygenase alpha chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Oxidoreductase

sp_Pdown

sp|P00436|PCXA_PSEPU

3

185

S=283 I=40 E=3.57796e-26

Protocatechuate 3,4-dioxygenase alpha chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Oxidoreductase

sp_Pdown

sp|P15110|PCXB_BURCE

22

163

S=216 I=36 E=4.08618e-18

Protocatechuate 3,4-dioxygenase beta chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Metal-binding Oxidoreductase

sp_Pdown

sp|P20372|PCXB_ACIAD

34

184

S=208 I=34 E=4.65321e-17

Protocatechuate 3,4-dioxygenase beta chain EC=1.13.11.3 ; Aromatic hydrocarbons catabolism Iron Metal-binding Oxidoreductase

PD002260

5

110

S=180 I=41 E=2.21482e-14

PDA1F8E7

126

185

S=111 I=43 E=5.17028e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one PPIad3hx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

71 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03520.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03520.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pcaB XFF4834R_chr03530
XFF4834R_chr03520
XFF4834R_chr03520
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03540
XFF4834R_chr03540
ID pcaB
AC XFF4834R_chr03530
LT XFF4834R_chr03530
OR XFF4834R_chr from 405131 to 406513 on strand +
DE probable 3-carboxy-cis,cis-muconate cycloisomerase protein
IP Fumarate lyase; Adenylosuccinate lyase, C-terminal; Fumarate lyase, conserved site
CL 1.1.5.4 Beta-ketoadipate pathway GO:0042952
EC
GO InterPro
Biological Process: protocatechuate catabolic process (GO:0019619)
Molecular Function: catalytic activity (GO:0003824)
cis-muconate cycloisomerase activity (GO:0047472)

Curated
PM
AN
CC COG: [F] Nucleotide transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120316)
MW 48395.1 Da
SQ 460 aa
 
........10........20........30........40........50
| | | | |
MLPVRLEMQCMSATSSLLGSLFGEPACDALFDAAARVQAMLQFESALARA
QAQCGVIPAQAAQAIAAACDVQHYDLAALAQATALAGNPAIPLVKALTAQ
VAAHDNAAARWVHWGATSQDVIDTGTVLQLRAALDLLLPRLHALCADLAV
LAERERNTGLPGRTLLQQAVPVTFGLKVAGWLDALQRAQQRLHALRRDAL
VLQFGGAAGTLASLQERGLDVAQALASTLELPLPALPWHTARDRIVEVGC
TFGLLAATLGKIGGDVVLLMQSEVGEAFEPAAAGKGGSSAMPHKRNPVSS
VAAVAAATRVPGLVATLFSAMAQPHERAAGQWHAEWDTLPQIVCLTAGSL
AQMQLCLSGLELDRTRMQAHLDSHGGLLYAEAAVFALAPHLGKPQAHALV
EQAALRAQAQQRHLREVLGEDAQVSAVLTHAQLQAVFDSDSWRGMSSVWI
DRVLARSSSC
Show or not Domain decomposition
 
XFF4834R

NP_640725.1 lcl|pcaB-XAC0369

11

459

S=1734 I=79 E=0

3-carboxy-cis,cis-muconate cycloisomerase

XFF4834R

YP_362114.1 lcl|pcaB-XCV0383

1

460

S=1689 I=78 E=0

3-carboxy-cis,cis-muconate cycloisomerase

XFF4834R

NP_635764.1 lcl|pcaB-XCC0369

11

459

S=1459 I=67 E=1.57125e-169

3-carboxy-cis,cis-muconate cycloisomerase

XFF4834R

lcl|pcaB-XALc_3028

11

455

S=1283 I=61 E=3.75711e-148

probable 3-carboxy-cis,cis-muconate cycloisomerase protein

pubmed

12

454

S=879 I=45 E=1.25821e-97

3-carboxy-cis,cis-muconate cycloisomerase EC=5.5.1.2 ; Aromatic hydrocarbons catabolism

Pubmed 9582432

 

prodomImg

pubmed

14

455

S=844 I=43 E=1.8244e-93

3-carboxy-cis,cis-muconate cycloisomerase

Pubmed 15301541

 

prodomImg

pubmed

14

455

S=844 I=43 E=1.99061e-93

PcaB-like protein

Pubmed 9642183

 

prodomImg

pubmed

14

433

S=786 I=44 E=2.31528e-86

3-carboxy-cis,cis-muconate cycloisomerase EC=5.5.1.2 ; Aromatic hydrocarbons catabolism Cytoplasm

Pubmed 1390752

 

prodomImg

pubmed

15

454

S=757 I=38 E=7.42862e-83

3-carboxy-cis,cis-muconate cycloisomerase EC=5.5.1.2 ; Aromatic hydrocarbons catabolism

Pubmed 8063101

 

prodomImg

pubmed

15

401

S=615 I=37 E=1.21439e-65

3-carboxy-cis,cis-muconate lactonizing enzyme EC=5.5.1.2 ; Isomerase

Pubmed 17074892

 

prodomImg

pubmed

11

456

S=584 I=35 E=5.61949e-62

3-carboxy-cis,cis-muconate cycloisomerase homologue

Pubmed 16452404

 

prodomImg

pubmed

16

388

S=552 I=39 E=5.50393e-58

3-carboxy-cis,cis-muconate cycloisomerase homolog EC=5.5.1.2

Pubmed 9495744

 

prodomImg

pubmed

15

455

S=545 I=35 E=3.23097e-57

Putative carboxymuconate cycloisomerase

Pubmed 17103476

 

prodomImg

pubmed

89

401

S=520 I=39 E=3.70535e-54

3-carboxy-cis,cis-muconate lactonizing enzyme EC=5.5.1.2 ; Isomerase

Pubmed 17074892

 

prodomImg

sp_Pdown

sp|O31385|PCAB_BRAJA

12

454

S=879 I=45 E=8.65912e-98

3-carboxy-cis,cis-muconate cycloisomerase EC=5.5.1.2 ; Aromatic hydrocarbons catabolism

sp_Pdown

sp|Q9I6Q8|PCAB_PSEAE

15

455

S=849 I=46 E=3.05794e-94

3-carboxy-cis,cis-muconate cycloisomerase EC=5.5.1.2 ; Aromatic hydrocarbons catabolism Cytoplasm

sp_Pdown

sp|P32427|PCAB_PSEPU

14

433

S=786 I=44 E=1.5934e-86

3-carboxy-cis,cis-muconate cycloisomerase EC=5.5.1.2 ; Aromatic hydrocarbons catabolism Cytoplasm

sp_Pdown

sp|Q59092|PCAB_ACIAD

15

454

S=757 I=38 E=5.11246e-83

3-carboxy-cis,cis-muconate cycloisomerase EC=5.5.1.2 ; Aromatic hydrocarbons catabolism

sp_Pdown

sp|O42889|YBN5_SCHPO

15

454

S=722 I=36 E=7.8112e-79

Uncharacterized protein C8E4.05c ; Cytoplasm Nucleus

PD000660

111

400

S=249 I=31 E=1.19661e-22

PDA275Y2

416

460

S=211 I=96 E=5.53257e-18

PDA0C3A0

47

110

S=159 I=55 E=9.0486e-12

PDA1S493

11

46

S=143 I=81 E=7.92608e-10

PD685849

15

102

S=138 I=36 E=3.64499e-09

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 8afu6mth)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

29 hits
swiss-prot

Swiss-Prot ncbi-blastp

54 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03530.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03530.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03530.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03530.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
pcaC XFF4834R_chr03550
XFF4834R_chr03540
XFF4834R_chr03540
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03560
XFF4834R_chr03560
ID pcaC
AC XFF4834R_chr03550
LT XFF4834R_chr03550
OR XFF4834R_chr from 407333 to 407746 on strand +
DE probable 4-carboxymuconolactone decarboxylase
IP Carboxymuconolactone decarboxylase
CL 1.1.5.4 Beta-ketoadipate pathway GO:0042952
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120319)
MW 15019.9 Da
SQ 137 aa
 
........10........20........30........40........50
| | | | |
MHEDERYQAGMRVRRRVLGDAHVDRALAARSDFTEEFQGLITRYAWGGIW
TRDGLPAHTRSLITLSMMIALGHDDEFKLHVRAARNNGVTPAQIKEVLLQ
AAIYCGVPAANHAFALARPILEEQAADAGTASTAQPG
Show or not Domain decomposition
 
XFF4834R

NP_640727.1 lcl|pcaC-XAC0371

1

137

S=703 I=98 E=1.27241e-78

4-carboxymuconolactone decarboxylase

XFF4834R

YP_362116.1 lcl|pcaC-XCV0385

1

136

S=627 I=93 E=1.91918e-69

4-carboxymuconolactone decarboxylase

XFF4834R

NP_635766.1 lcl|pcaC-XCC0371

1

132

S=575 I=83 E=3.51556e-63

4-carboxymuconolactone decarboxylase

XFF4834R

lcl|pcaC-XALc_3026

1

127

S=481 I=78 E=9.32996e-52

probable 4-carboxymuconolactone decarboxylase protein

Iprscan [G3DSA:1.20.1290.10]

19

137

-

Iprscan IPR003779 [PF02627]

36

118

Carboxymuconolactone decarboxylase

Iprscan IPR012788 [TIGR02425]

3

125

4-carboxymuconolactone decarboxylase

Iprscan [SSF69118]

6

123

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one WNJSJHGn)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

24 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03550.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03550.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB8Qt4DJ/XFF4834R_chr03550.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.