Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr06610XFF4834R_chr_0753670_0754776_f1_XFF4834R-XFF4834R_chr06610XFF4834R_chr06610Probable formaldehyde dehydrogenase (Glutathione)

XFF4834R_chr_0753670_0754776_f1_XFF4834R-XFF4834R_chr06610 XFF4834R_chr06610
XFF4834R_chr06600
XFF4834R_chr06600
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr06620
XFF4834R_chr06620
ID XFF4834R_chr_0753670_0754776_f1_XFF4834R-XFF4834R_chr06610
AC XFF4834R_chr06610
LT XFF4834R_chr06610
OR XFF4834R_chr from 753670 to 754776 on strand +
DE Probable formaldehyde dehydrogenase (Glutathione)
IP Alcohol dehydrogenase GroES-like; Alcohol dehydrogenase class III/S-(hydroxymethyl)glutathione dehydrogenase;
CL 1.1.5.2 Ethanol degradation GO:0006068
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: ethanol oxidation (GO:0006069)
Molecular Function: S-(hydroxymethyl)glutathione dehydrogenase activity (GO:0051903)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: zinc ion binding (GO:0008270)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100503)
MW 38803.1 Da
SQ 368 aa
 
........10........20........30........40........50
| | | | |
MKTRAAVAWGPHQPLTIEEVDLQPPRPGEVLVRLVATGICHGDAHALAHG
HVGSFPAILGQEGAGIVEDVGIGVTSVRPGDHVIPLYMPECGVCKFCRSG
RTNLCQAIRSSQERGLMPDGSSRFSLHGRPILHHMGTSTFSEYTVLPEIA
VARIHPDAPLEQACLLGCTVTTGVGAVLNSTHVRPGDCVAVFGLGGIGLS
VIQGALLAQAGRIIAVDIDPAKFALARTLGATDCLDPHDYGAPIQQVIVD
LTDGGADHSFECVGDVGAMRAALECCHKGWGESVILGMADDAQEISTRPF
QLVTGRVWRGSAFGGVKGRSELPGYVERYLHGDIQLAPLITRTLALDDIN
QALTDLRAARGIKSIVAY
XFF4834R

XFF4834R_chr07420 lcl|frmA-XFF4834R_chr07420

1

368

S=1299 I=64 E=7.95113e-151

alcohol dehydrogenase class III/glutathione-dependent formaldehyde dehydrogenase

XFF4834R

XFF4834R_chr36380 lcl|XFF4834R_chr39550802_4213965_f1_XFF4834R-XFF4834R_chr36380

29

264

S=208 I=34 E=1.38143e-18

predicted oxidoreductase, Zn-dependent and NAD(P)-binding

XFF4834R

XFF4834R_chr21310 lcl|XFF4834R_chr23210834_2474003_f3_XFF4834R-XFF4834R_chr21310

6

264

S=177 I=28 E=6.9748e-15

XFF4834R

XFF4834R_chr10280 lcl|tdh-XFF4834R_chr10280

4

368

S=146 I=23 E=4.49527e-11

threonine 3-dehydrogenase, NAD(P)-binding

XFF4834R

XFF4834R_chr18010 lcl|XFF4834R_chr19230687_2062727_r2_XFF4834R-XFF4834R_chr18010

18

362

S=129 I=26 E=4.11306e-09

XFF4834R

XFF4834R_chr00320 lcl|XFF4834R_chr_0036417_0037475_f3_XFF4834R-XFF4834R_chr00320

13

107

S=117 I=31 E=1.33346e-07

predicted oxidoreductase, Zn-dependent and NAD(P)-binding

XFF4834R

XFF4834R_chr17360 lcl|XFF4834R_chr18520017_1987024_f2_XFF4834R-XFF4834R_chr17360

161

353

S=104 I=30 E=4.84196e-06

XFF4834R

XFF4834R_chr07420 lcl|frmA-XFF4834R_chr07420

1

368

S=1299 I=64 E=7.95113e-151

alcohol dehydrogenase class III/glutathione-dependent formaldehyde dehydrogenase

XFF4834R

XFF4834R_chr36380 lcl|XFF4834R_chr39550802_4213965_f1_XFF4834R-XFF4834R_chr36380

29

264

S=208 I=34 E=1.38143e-18

predicted oxidoreductase, Zn-dependent and NAD(P)-binding

XFF4834R

XFF4834R_chr21310 lcl|XFF4834R_chr23210834_2474003_f3_XFF4834R-XFF4834R_chr21310

6

264

S=177 I=28 E=6.9748e-15

XFF4834R

NP_641005.1 lcl|adhC-XAC0652

1

368

S=1889 I=98 E=0

alcohol dehydrogenase class III

XFF4834R

YP_362444.1 lcl|XCV0713

1

368

S=1847 I=96 E=0

putative alcohol dehydrogenase class III

XFF4834R

NP_638821.1 lcl|adhC-XCC3475

1

368

S=1776 I=93 E=0

alcohol dehydrogenase class III

XFF4834R

YP_362519.1 lcl|XCV0788

1

368

S=1298 I=64 E=3.93568e-150

putative alcohol dehydrogenase class III

XFF4834R

NP_641087.1 lcl|XAC0734-XAC0734

1

368

S=1295 I=64 E=7.83707e-150

alcohol dehydrogenase C

XFF4834R

NP_638735.1 lcl|XCC3389

1

368

S=1293 I=63 E=1.45544e-149

alcohol dehydrogenase C

XFF4834R

lcl|XALc_0862

1

368

S=1257 I=64 E=3.85153e-145

putative alcohol dehydrogenase class III protein

XFF4834R

lcl|XALc_1049

4

231

S=219 I=34 E=1.91626e-19

putative zinc-containing alcohol dehydrogenase superfamily protein

XFF4834R

NP_639049.1 lcl|ybdR-XCC3703

29

264

S=207 I=33 E=6.89775e-18

Zn-dependent alcohol dehydrogenase

XFF4834R

NP_644054.1 lcl|ybdR-XAC3747

29

264

S=204 I=33 E=1.3498e-17

Zn-dependent alcohol dehydrogenase

pubmed

1

366

S=1253 I=64 E=4.32585e-143

Putative formaldehyde dehydrogenase (Glutathione-dependent) ; Metal-binding Oxidoreductase Zinc

Pubmed 9098058,10591845

 

prodomImg

pubmed

1

368

S=1213 I=61 E=2.83469e-138

Glutathione-dependent formaldehyde dehydrogenase ; Metal-binding Oxidoreductase Zinc

Pubmed 11577159

 

prodomImg

pubmed

1

368

S=1176 I=60 E=9.00867e-134

Putative alcohol dehydrogenase class III ; Metal-binding Oxidoreductase Plasmid Zinc

Pubmed 18070959

 

prodomImg

pubmed

1

368

S=1175 I=60 E=1.09135e-133

Putative alcohol dehydrogenase class III ; Metal-binding Oxidoreductase Plasmid Zinc

Pubmed 18070959

 

prodomImg

pubmed

1

368

S=1174 I=60 E=1.74757e-133

Putative alcohol dehydrogenase ; Metal-binding Oxidoreductase Plasmid Zinc

Pubmed 16940067

 

prodomImg

pubmed

1

368

S=1169 I=59 E=6.51924e-133

Formaldehyde dehydrogenase (Glutathione) EC=1.2.1.1 ; Metal-binding Oxidoreductase Zinc

Pubmed 8891129

 

prodomImg

pubmed

1

368

S=1166 I=59 E=1.36789e-132

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Plasmid Zinc

Pubmed 8052160

 

prodomImg

pubmed

1

368

S=1133 I=54 E=1.46181e-128

Alcohol dehydrogenase class-3 EC=1.1.1.1 EC=1.1.1.284 EC=1.1.1.- ; Acetylation Cytoplasm Metal-binding NAD Oxidoreductase Zinc

Pubmed 7589468

 

prodomImg

pubmed

1

368

S=1132 I=55 E=1.86601e-128

Alcohol dehydrogenase 5 ; Metal-binding Oxidoreductase Zinc

Pubmed 15128875

 

prodomImg

pubmed

1

368

S=1127 I=54 E=8.21522e-128

Alcohol dehydrogenase class-3 chain L EC=1.1.1.1 EC=1.1.1.284 EC=1.1.1.- ; Acetylation Cytoplasm Metal-binding NAD Oxidoreductase Zinc

Pubmed 8931553,7607314

 

prodomImg

sp_Pdown

sp|P73138|FRMA_SYNY3

1

368

S=1228 I=62 E=2.72107e-140

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

sp_Pdown

sp|Q1RFI7|FRMA_ECOUT

1

368

S=1184 I=60 E=7.19475e-135

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

sp_Pdown

sp|Q0TKS7|FRMA_ECOL5

1

368

S=1184 I=60 E=7.19475e-135

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

sp_Pdown

sp|A1A835|FRMA_ECOK1

1

368

S=1184 I=60 E=7.19475e-135

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

sp_Pdown

sp|Q3Z550|FRMA_SHISS

1

368

S=1183 I=60 E=9.67735e-135

S-(hydroxymethyl)glutathione dehydrogenase EC=1.1.1.284 EC=1.1.1.- EC=1.1.1.1 ; Cytoplasm Metal-binding NAD Oxidoreductase Zinc

PD842149

258

305

S=209 I=77 E=8.99848e-18

PDA1H438

75

118

S=203 I=80 E=4.4371e-17

PDA1Z4J3

329

368

S=193 I=95 E=7.35113e-16

PDA1G6U7

293

323

S=153 I=87 E=5.34843e-11

PD499457

258

368

S=146 I=32 E=3.77054e-10

PD270708

150

191

S=131 I=62 E=1.99188e-08

PD886660

116

146

S=124 I=68 E=1.61445e-07

PDA1R135

306

328

S=122 I=100 E=2.7479e-07

PDA294E2

159

215

S=121 I=46 E=3.30003e-07

PDA6T5W3

191

237

S=120 I=49 E=5.47187e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uUs7Bg8C)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

368 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

7 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMTzPCO/XFF4834R_chr06610.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMTzPCO/XFF4834R_chr06610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMTzPCO/XFF4834R_chr06610.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBMTzPCO/XFF4834R_chr06610.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.