Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr01630XFF4834R_chr01780601_0201029_f3_XFF4834R-XFF4834R_chr01630XFF4834R_chr01630putative thioesterase
  2. XFF4834R_chr08860XFF4834R_chr08860 probable p-hydroxycinnamoyl CoA hydratase/lyase
  3. XFF4834R_chr31920paaFXFF4834R_chr31920probable enoyl-CoA hydratase-isomerase

XFF4834R_chr01780601_0201029_f3_XFF4834R-XFF4834R_chr01630 XFF4834R_chr01630
XFF4834R_chr01620
XFF4834R_chr01620
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01640
XFF4834R_chr01640
ID XFF4834R_chr01780601_0201029_f3_XFF4834R-XFF4834R_chr01630
AC XFF4834R_chr01630
LT XFF4834R_chr01630
OR XFF4834R_chr from 200601 to 201029 on strand +
DE putative thioesterase
IP Phenylacetic acid degradation-related protein
CL 1.1.5.1 Phenylacetic acid degradation GO:0010124
EC
GO InterPro


Curated
PM
AN PaaI_thioesterase is a tetrameric acyl-CoA thioesterase with a hot dog fold and one of several proteins responsible for phenylacetic acid (PA) degradation in bacteria. Although orthologs of PaaI exist in archaea and eukaryotes, their function has not been determined. Sequence similarity between PaaI, E. coli medium chain acyl-CoA thioesterase II, and human thioesterase III suggests they all belong to the same thioesterase superfamily. The conserved fold present in these thioesterases is referred to as an asymmetric hot dog fold, similar to those of 4-hydroxybenzoyl-CoA thioesterase (4HBT) and the beta-hydroxydecanoyl-ACP dehydratases (FabA/FabZ).
CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 15012 Da
SQ 142 aa
 
........10........20........30........40........50
| | | | |
MTFREPVDLAALNAASRDTLIEHLGIVFTEAGDDWLRATMPVDARTRQPY
GLLHGGASVVLAETVGSSAGNLCVDMATQICVGLEINANHLRAATQGLVT
GTARAVHVGRSTHVWDITIENPAGKRVCVSRLTLAVVPRSNG
pubmed

3

140

S=390 I=52 E=2.8781e-39

Putative uncharacterized protein

Pubmed 9683477

 

prodomImg

pubmed

1

137

S=322 I=47 E=5.17234e-31

Esterase ybdB EC=3.1.-.- ; Hydrolase

Pubmed 2521621,2521622

 

prodomImg

pubmed

7

137

S=319 I=51 E=1.22617e-30

ComA-like protein

Pubmed 15077674

 

prodomImg

pubmed

16

141

S=304 I=48 E=7.71153e-29

YuxO protein

Pubmed 12007649

 

prodomImg

pubmed

17

139

S=299 I=49 E=3.03125e-28

ComA operon protein 2

Pubmed 2507523,9274030

 

prodomImg

pubmed

18

139

S=294 I=50 E=1.31146e-27

Putative uncharacterized protein yuxO

Pubmed 17827323

 

prodomImg

pubmed

16

128

S=274 I=48 E=3.35716e-25

ComAB protein

Pubmed 9765590

 

prodomImg

pubmed

15

141

S=158 I=31 E=4.62149e-11

4-chlorobenzoate thioesterase ; Plasmid

Pubmed 16597946

 

prodomImg

pubmed

15

141

S=158 I=31 E=4.62149e-11

4-chlorobenzoyl CoA thioesterase

Pubmed 17384944

 

prodomImg

pubmed

15

141

S=158 I=31 E=4.62149e-11

FcbC1 ; Plasmid

Pubmed 1476446,12907670

 

prodomImg

sp_Pdown

sp|Q9I3A4|Y1618_PSEAE

3

138

S=406 I=57 E=2.52106e-41

UPF0152 protein PA1618

sp_Pdown

sp|Q9KM09|Y3380_VIBCH

3

136

S=384 I=57 E=1.25191e-38

UPF0152 protein VC_A0580

sp_Pdown

sp|Q9CMM9|Y788_PASMU

1

136

S=360 I=51 E=8.50904e-36

UPF0152 protein PM0788

sp_Pdown

sp|P77781|YDII_ECOLI

1

137

S=352 I=51 E=8.42813e-35

Esterase ydiI EC=3.1.-.- ; Hydrolase

sp_Pdown

sp|P45083|Y1161_HAEIN

1

137

S=344 I=49 E=8.13247e-34

UPF0152 protein HI1161

PD397580

48

141

S=136 I=34 E=5.92488e-09

PD963303

18

117

S=113 I=28 E=3.23834e-06

PD006741

17

71

S=104 I=43 E=4.42868e-05

PDA7W919

75

136

S=102 I=34 E=6.61383e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one BJ8bNZHk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

11 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr01630.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr01630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr01630.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr01630.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr08860
XFF4834R_chr08850
XFF4834R_chr08850
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08870
XFF4834R_chr08870
ID
AC XFF4834R_chr08860
LT XFF4834R_chr08860
OR XFF4834R_chr from 1028000 to 1028827 on strand -
DE probable p-hydroxycinnamoyl CoA hydratase/lyase
IP Crotonase, core
CL 1.1.5.1 Phenylacetic acid degradation GO:0010124
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN crotonase like family
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130521)
MW 31197.3 Da
SQ 275 aa
 
........10........20........30........40........50
| | | | |
MNEHDVVSVRIENRIAWVKFARPDKRNAMSPALNRRMMDVLDELEFDDNV
GVLVLGGEGTAWSAGMDLKEYFRETEAQGLRGVRRSQRESYGWFRRLRWY
QKPTIAMVNGWCFGGGFGPLFACDLAIAADEAQFGLSEINWGILPGGGVT
KVAVELLSMRDAMWMTLTGEMVDGKKAAEWRLVNESVPLERLEARTREVA
ELLLRKNPVALKYAKDAVRRVGTMTYDEAEDYLVRMQEAANSFDNNARKE
GIRQFIDEKSYKPGLGEYDLSKHSA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr29290 lcl|XFF4834R_chr31820199_3365981_f3_XFF4834R-XFF4834R_chr29290

1

262

S=262 I=31 E=2.36497e-25

XFF4834R

XFF4834R_chr31920 lcl|paaF-XFF4834R_chr31920

4

260

S=210 I=29 E=4.44698e-19

enoyl-CoA hydratase-isomerase

XFF4834R

XFF4834R_chr19980 lcl|XFF4834R_chr21440357_2292154_r3_XFF4834R-XFF4834R_chr19980

18

193

S=207 I=32 E=1.06345e-18

XFF4834R

XFF4834R_chr31830 lcl|fadJ-XFF4834R_chr31830

27

185

S=177 I=32 E=5.27649e-15

fused enoyl-CoA hydratase and epimerase and isomerase/3-hydroxyacyl-CoA dehydrogenase

XFF4834R

XFF4834R_chr20190 lcl|XFF4834R_chr21700528_2317397_r2_XFF4834R-XFF4834R_chr20190

48

188

S=106 I=27 E=2.06027e-06

XFF4834R

XFF4834R_chr21160 lcl|XFF4834R_chr23040207_2457579_r1_XFF4834R-XFF4834R_chr21160

15

154

S=97 I=29 E=2.09476e-05

XFF4834R

NP_641235.1 lcl|fadB-XAC0883

1

275

S=1450 I=100 E=1.12534e-168

p-hydroxycinnamoyl CoA hydratase/lyase

XFF4834R

YP_362649.1 lcl|paaF-XCV0918

1

275

S=1445 I=100 E=4.30927e-168

p-hydroxycinnamoyl CoA hydratase/lyase

XFF4834R

NP_636201.1 lcl|fadB-XCC0810

1

269

S=1379 I=96 E=4.31806e-160

p-hydroxycinnamoyl CoA hydratase/lyase

XFF4834R

lcl|XALc_3045

6

268

S=687 I=51 E=3.04548e-76

putative enoyl-coa hydratase protein

XFF4834R

lcl|XALc_1063

1

229

S=284 I=36 E=1.73259e-27

hypothetical enoyl-coa hydratase/isomerase; protein

XFF4834R

YP_363356.1 lcl|XCV1625

1

262

S=278 I=32 E=1.18991e-26

3-hydroxybutyryl-CoA dehydratase

XFF4834R

NP_636905.1 lcl|crt-XCC1534

1

262

S=269 I=32 E=1.47847e-25

3-hydroxybutyryl-CoA dehydratase

XFF4834R

lcl|XALc_1333

22

234

S=267 I=34 E=2.40911e-25

putative enoyl-coa hydratase protein

XFF4834R

lcl|XALc_1985

12

262

S=266 I=32 E=2.89316e-25

putative 3-hydroxybutyryl-coa dehydratase protein

XFF4834R

NP_641916.1 lcl|crt-XAC1584

1

262

S=262 I=31 E=9.63631e-25

3-hydroxybutyryl-CoA dehydratase

XFF4834R

NP_641649.1 lcl|paaF-XAC1314

4

260

S=219 I=30 E=1.55008e-19

enoyl-CoA hydratase

XFF4834R

YP_363096.1 lcl|XCV1365

4

260

S=216 I=29 E=3.08666e-19

enoyl-CoA hydratase

XFF4834R

YP_363630.1 lcl|XCV1899

18

193

S=207 I=33 E=3.80192e-18

enoyl-CoA hydratase

XFF4834R

NP_642179.1 lcl|XAC1853-XAC1853

18

193

S=206 I=32 E=5.29529e-18

enoyl-CoA hydratase

XFF4834R

NP_636636.1 lcl|paaF-XCC1262

4

260

S=200 I=27 E=3.00196e-17

enoyl-CoA hydratase

XFF4834R

NP_636640.1 lcl|fadB-XCC1266

27

185

S=185 I=33 E=2.1896e-15

3-hydroxyacyl-CoA dehydrogenase

XFF4834R

YP_363100.1 lcl|fadB-XCV1369

27

185

S=177 I=32 E=1.699e-14

fatty oxidation complex alpha subunit

XFF4834R

lcl|fadJ-XALc_2548

27

185

S=176 I=33 E=2.11279e-14

probable fatty acid oxidation complex, alpha subunit fadj protein

XFF4834R

NP_641653.1 lcl|fadB-XAC1318

27

185

S=176 I=32 E=2.18777e-14

3-hydroxyacyl-CoA dehydrogenase

XFF4834R

NP_637198.1 lcl|XCC1833

18

204

S=166 I=32 E=3.46996e-13

enoyl-CoA hydratase

XFF4834R

lcl|XALc_0912

53

195

S=112 I=26 E=1.46794e-06

putative enoyl-coa hydratase/isomerase protein

XFF4834R

YP_363651.1 lcl|rpfF-XCV1920

48

188

S=107 I=27 E=5.77018e-06

enoyl-CoA hydratase

XFF4834R

NP_637222.1 lcl|rpfF-XCC1857

104

188

S=106 I=29 E=6.57638e-06

enoyl-CoA hydratase

XFF4834R

NP_642339.2 lcl|fadB-XAC2013

15

154

S=103 I=30 E=1.92188e-05

3-hydroxyacyl-CoA dehydrogenase

XFF4834R

YP_363795.1 lcl|fadB-XCV2064

15

154

S=97 I=29 E=8.53531e-05

3-hydroxyacyl-CoA dehydrogenase

pubmed

2

275

S=1090 I=72 E=1.72576e-123

Enoyl-CoA hydratase/aldolase

Pubmed 11728709

 

prodomImg

pubmed

3

272

S=965 I=65 E=2.43661e-108

Feruloyl-CoA hydratase/lyase

Pubmed 12200295,15090517

 

prodomImg

pubmed

5

268

S=728 I=53 E=1.2585e-79

4-hydroxycinnamoyl CoA hydratase/lyase Enoyl-CoA hydratase/lyase EC=4.2.1.17

Pubmed 9515921,2298704

 

prodomImg

pubmed

5

268

S=716 I=55 E=3.30973e-78

Feruloyl-CoA hydratase/lyase

Pubmed 12200295

 

prodomImg

pubmed

6

268

S=706 I=54 E=6.41512e-77

Feruloyl-CoA hydratase

Pubmed 18575856

 

prodomImg

sp_Pdown

sp|P34559|ECHM_CAEEL

12

263

S=285 I=31 E=4.30161e-26

Probable enoyl-CoA hydratase, mitochondrial EC=4.2.1.17 ; Fatty acid metabolism Lipid Lyase Mitochondrion

sp_Pdown

sp|P64016|ECHA8_MYCTU

4

260

S=281 I=29 E=1.44529e-25

Probable enoyl-CoA hydratase echA8 EC=4.2.1.17 ; Fatty acid metabolism Lipid Lyase

sp_Pdown

sp|P64017|ECHA8_MYCBO

4

260

S=281 I=29 E=1.44529e-25

Probable enoyl-CoA hydratase echA8 EC=4.2.1.17 ; Fatty acid metabolism Lipid Lyase

sp_Pdown

sp|Q8BH95|ECHM_MOUSE

13

259

S=276 I=30 E=4.68957e-25

Enoyl-CoA hydratase, mitochondrial EC=4.2.1.17 ; Acetylation Fatty acid metabolism Lipid Lyase Mitochondrion Transit peptide

sp_Pdown

sp|O34893|YNGF_BACSU

1

259

S=276 I=30 E=5.58294e-25

Putative enoyl-CoA hydratase/isomerase yngF ; Lyase

Iprscan [G3DSA:3.90.226.10]

5

259

-

Iprscan [PTHR11941]

9

260

-

Iprscan IPR001753 [PF00378]

17

188

Crotonase, core

PD020257

214

268

S=182 I=63 E=1.52556e-14

PD000432

93

184

S=132 I=38 E=1.36714e-08

PDA9K2A5

103

205

S=107 I=29 E=1.8829e-05

Iprscan [SSF52096]

3

263

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one epds83gd)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

198 hits
swiss-prot

Swiss-Prot ncbi-blastp

328 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

7 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr08860.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr08860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr08860.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr08860.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
paaF XFF4834R_chr31920
XFF4834R_chr31910
XFF4834R_chr31910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31930
XFF4834R_chr31930
ID paaF
AC XFF4834R_chr31920
LT XFF4834R_chr31920
OR XFF4834R_chr from 3662480 to 3663277 on strand -
DE probable enoyl-CoA hydratase-isomerase
IP Crotonase, core
CL 1.1.5.1 Phenylacetic acid degradation GO:0010124
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN The 14 paa genes are organized in three transcription units: paaZ and paaABCDEFGHIJK, encoding catabolic genes; and paaXY, containing the paaX regulatory gene.
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100819)
MW 28231.7 Da
SQ 265 aa
 
........10........20........30........40........50
| | | | |
MSDWEGRLHTGLQVERDGHVAIVTLSNPPANTWTVHSLAALRELVRALDA
DRSIYALVITGEGEKFFSAGADLKQFADGDKANAREAARRFGEAFEALSA
FRGVSIAAINGYAMGGGLECALACDLRIAEQHAQLALPEASVGLLPCAGG
TQNLPRLVGEGWAKRMILLGERIDAATAQRIGLVEEVVGKGESRALAVAW
AQRAGKQSPVSVAACKQLVQSTRHGTHAAALIAEREAFVDLFEHADQAEG
VAAFLDKRAPQWSNR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr29290 lcl|XFF4834R_chr31820199_3365981_f3_XFF4834R-XFF4834R_chr29290

20

265

S=305 I=35 E=1.31603e-30

XFF4834R

XFF4834R_chr31830 lcl|fadJ-XFF4834R_chr31830

16

187

S=209 I=33 E=5.64169e-19

fused enoyl-CoA hydratase and epimerase and isomerase/3-hydroxyacyl-CoA dehydrogenase

XFF4834R

XFF4834R_chr08860 lcl|XFF4834R_chr09440000_1028827_r3_XFF4834R-XFF4834R_chr08860

9

259

S=185 I=27 E=5.29438e-16

XFF4834R

XFF4834R_chr19980 lcl|XFF4834R_chr21440357_2292154_r3_XFF4834R-XFF4834R_chr19980

10

262

S=182 I=29 E=1.17054e-15

XFF4834R

XFF4834R_chr32960 lcl|XFF4834R_chr35680747_3795517_f2_XFF4834R-XFF4834R_chr32960

12

202

S=157 I=31 E=1.40222e-12

XFF4834R

XFF4834R_chr20190 lcl|XFF4834R_chr21700528_2317397_r2_XFF4834R-XFF4834R_chr20190

102

222

S=151 I=35 E=5.91002e-12

XFF4834R

XFF4834R_chr21160 lcl|XFF4834R_chr23040207_2457579_r1_XFF4834R-XFF4834R_chr21160

9

154

S=105 I=29 E=2.19552e-06

XFF4834R

XFF4834R_chr31910 lcl|XFF4834R_chr_3661293_3662480_r2_XFF4834R-XFF4834R_chr31910

110

185

S=103 I=37 E=4.85411e-06

XFF4834R

YP_363096.1 lcl|XCV1365

1

265

S=1275 I=94 E=1.38817e-147

enoyl-CoA hydratase

XFF4834R

NP_641649.1 lcl|paaF-XAC1314

1

265

S=1272 I=94 E=3.75063e-147

enoyl-CoA hydratase

XFF4834R

NP_636636.1 lcl|paaF-XCC1262

1

264

S=1154 I=85 E=7.91504e-133

enoyl-CoA hydratase

XFF4834R

lcl|XALc_1985

10

265

S=330 I=35 E=5.22755e-33

putative 3-hydroxybutyryl-coa dehydratase protein

XFF4834R

YP_363356.1 lcl|XCV1625

20

265

S=313 I=37 E=6.10562e-31

3-hydroxybutyryl-CoA dehydratase

XFF4834R

NP_641916.1 lcl|crt-XAC1584

20

265

S=310 I=36 E=1.15384e-30

3-hydroxybutyryl-CoA dehydratase

XFF4834R

lcl|XALc_1063

15

265

S=294 I=34 E=1.06498e-28

hypothetical enoyl-coa hydratase/isomerase; protein

XFF4834R

NP_636905.1 lcl|crt-XCC1534

54

265

S=289 I=36 E=4.33479e-28

3-hydroxybutyryl-CoA dehydratase

XFF4834R

NP_641653.1 lcl|fadB-XAC1318

16

207

S=213 I=33 E=7.64915e-19

3-hydroxyacyl-CoA dehydrogenase

XFF4834R

lcl|XALc_1333

8

262

S=212 I=30 E=1.04695e-18

putative enoyl-coa hydratase protein

pubmed

14

265

S=394 I=35 E=3.51517e-39

3-hydroxybutyryl-CoA dehydratase EC=4.2.1.55 ; Fatty acid metabolism Lipid Lyase

Pubmed 8655474

 

prodomImg

pubmed

12

265

S=392 I=39 E=7.06101e-39

Probable enoyl-CoA hydratase paaF EC=4.2.1.17 ; Fatty acid metabolism Lipid Lyase

Pubmed 9748275

 

prodomImg

pubmed

16

258

S=377 I=37 E=3.79577e-37

Putative enoyl-CoA hydratase/isomerase yngF ; Lyase

Pubmed 9387222

 

prodomImg

pubmed

12

263

S=374 I=35 E=1.02556e-36

Putative enoyl-CoA hydratase

Pubmed 19854898

 

prodomImg

pubmed

10

265

S=370 I=35 E=3.21361e-36

Enoyl CoA hydratase

Pubmed 10086842

 

prodomImg

sp_Pdown

sp|P52046|CRT_CLOAB

14

265

S=394 I=35 E=2.3951e-39

3-hydroxybutyryl-CoA dehydratase EC=4.2.1.55 ; Fatty acid metabolism Lipid Lyase

sp_Pdown

sp|P76082|PAAF_ECOLI

12

265

S=392 I=39 E=4.81109e-39

Probable enoyl-CoA hydratase paaF EC=4.2.1.17 ; Fatty acid metabolism Lipid Lyase

sp_Pdown

sp|O34893|YNGF_BACSU

16

258

S=377 I=37 E=2.58628e-37

Putative enoyl-CoA hydratase/isomerase yngF ; Lyase

sp_Pdown

sp|P64016|ECHA8_MYCTU

9

265

S=376 I=37 E=3.86238e-37

Probable enoyl-CoA hydratase echA8 EC=4.2.1.17 ; Fatty acid metabolism Lipid Lyase

sp_Pdown

sp|P64017|ECHA8_MYCBO

9

265

S=376 I=37 E=3.86238e-37

Probable enoyl-CoA hydratase echA8 EC=4.2.1.17 ; Fatty acid metabolism Lipid Lyase

Iprscan [G3DSA:3.90.226.10]

12

263

-

Iprscan [PTHR11941]

14

262

-

Iprscan IPR001753 [PF00378]

22

188

Crotonase, core

Iprscan IPR018376 [PS00166]

106

126

Enoyl-CoA hydratase/isomerase, conserved site

Iprscan [seg]

82

97

-

PDA1S4O2

1

39

S=209 I=97 E=9.00977e-18

PD000432

106

184

S=188 I=56 E=2.53853e-15

PDA233F1

202

237

S=178 I=100 E=4.92033e-14

PDA1M2X0

104

218

S=137 I=34 E=4.45174e-09

PDA4D9B7

157

262

S=126 I=39 E=9.33296e-08

PDA2Y7S6

211

264

S=124 I=49 E=1.52077e-07

PDA1S6B7

104

187

S=118 I=38 E=7.97076e-07

PDA2S5P4

106

211

S=117 I=33 E=1.26527e-06

PDA241O5

124

188

S=113 I=38 E=3.13315e-06

PDA2U205

1

45

S=112 I=47 E=4.36383e-06

Iprscan [SSF52096]

5

265

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one MWERihPy)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

206 hits
swiss-prot

Swiss-Prot ncbi-blastp

335 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr31920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr31920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr31920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJwFO0r/XFF4834R_chr31920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.