Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr02380caiAXFF4834R_chr02380crotonobetaine reductase subunit II, FAD-binding
  2. XFF4834R_chr31230XFF4834R_chr_3591789_3593039_f3_XFF4834R-XFF4834R_chr31230XFF4834R_chr31230putative flavin containing amine oxidoreductase

caiA XFF4834R_chr02380
XFF4834R_chr02370
XFF4834R_chr02370
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02390
XFF4834R_chr02390
ID caiA
AC XFF4834R_chr02380
LT XFF4834R_chr02380
OR XFF4834R_chr from 282092 to 283255 on strand -
DE crotonobetaine reductase subunit II, FAD-binding
IP Acyl-CoA oxidase/dehydrogenase, type1/2, C-terminal; Acyl-CoA dehydrogenase/oxidase, N-terminal; Cyclohexanecarboxyl-CoA dehydrogenase
CL 1.1.4.2 Carnitine degradation GO:0042413
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995)
Molecular Function: FAD binding (GO:0050660)
acting on the CH-CH group of donors (GO:0016627)

Curated
PM
AN blastp avec caiA coli 28 pourcent sur tout le gene chez xav le nom est acdA qui n existe pas chez coli
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100622)
MW 41526.1 Da
SQ 387 aa
 
........10........20........30........40........50
| | | | |
MHVPSLNFELGEEIDLLRESVAAFASHHIAPLAAAADHDNVFPAQLWRLL
GEQGLLGLTVEDAYGGSGMGYLAHVVAMEEISRAGGAIGLSYGAHSNLCL
NQLRKNARHEQKQRYLPKLCSGEHVGALAMSEAGSGSDVVSMKLRADARG
DRYVLNGSKMWITNGPDADVLVVYAKTDPDAGARGITAFIVEKGMPGFST
AQKLDKLGMRGSNTCELVFTDCEVPAENVLGTLNGGVRVLMSGLDFERVV
LAGGPLGLMAAAMDVVLPYVHERKQFGEPIGTFQLMQAKLADMYVGLNAC
RAYVYAVARACDAGRTTRQDAAGAILYAAEKATWLTGQAIQVLGGNGYIN
DYPTGRLWRDAKLYEIGAGTSEIRRMLIGRELFERTA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr29520 lcl|XFF4834R_chr_3391021_3392217_r1_XFF4834R-XFF4834R_chr29520

42

380

S=637 I=41 E=1.31209e-70

predicted acyl-CoA dehydrogenase

XFF4834R

XFF4834R_chr31930 lcl|XFF4834R_chr34470274_3664455_r1_XFF4834R-XFF4834R_chr31930

42

383

S=452 I=34 E=4.00156e-48

XFF4834R

XFF4834R_chr30260 lcl|XFF4834R_chr32890335_3480498_r1_XFF4834R-XFF4834R_chr30260

42

382

S=329 I=29 E=2.51126e-33

XFF4834R

XFF4834R_chr26000 lcl|XFF4834R_chr28470188_3004981_f2_XFF4834R-XFF4834R_chr26000

52

219

S=164 I=33 E=2.53511e-13

XFF4834R

XFF4834R_chr15840 lcl|fadE-XFF4834R_chr15840

42

378

S=134 I=23 E=1.36052e-09

acyl coenzyme A dehydrogenase

XFF4834R

NP_635641.1 lcl|acdA-XCC0246

1

387

S=1747 I=87 E=0

acyl-CoA dehydrogenase

XFF4834R

NP_640621.1 lcl|acdA-XAC0265

1

387

S=1708 I=88 E=0

acyl-CoA dehydrogenase

XFF4834R

YP_362004.1 lcl|acdA-XCV0273

1

387

S=1704 I=88 E=0

acyl-CoA dehydrogenase

XFF4834R

lcl|XALc_0151

1

386

S=1571 I=78 E=0

putative acyl-coa dehydrogenase protein

XFF4834R

lcl|XALc_1764

42

380

S=667 I=42 E=1.04497e-73

putative acyl-coa dehydrogenase oxidoreductase protein

XFF4834R

NP_636886.1 lcl|acdA-XCC1514

42

380

S=646 I=41 E=4.63311e-71

acyl-CoA dehydrogenase

XFF4834R

YP_363336.1 lcl|acdA-XCV1605

42

380

S=641 I=41 E=1.50332e-70

acyl-CoA dehydrogenase

XFF4834R

NP_641895.1 lcl|acdA-XAC1562

42

380

S=639 I=41 E=2.99354e-70

acyl-CoA dehydrogenase

XFF4834R

NP_636635.1 lcl|fadE9-XCC1261

42

383

S=466 I=34 E=2.55849e-49

acyl-CoA dehydrogenase

XFF4834R

NP_641648.1 lcl|fadE9-XAC1313

42

383

S=463 I=34 E=6.22598e-49

acyl-CoA dehydrogenase

XFF4834R

YP_363095.1 lcl|XCV1364

42

383

S=461 I=34 E=1.00569e-48

acyl-CoA dehydrogenase

XFF4834R

YP_363260.1 lcl|XCV1529

42

382

S=322 I=28 E=8.4015e-32

glutaryl-CoA dehydrogenase

XFF4834R

NP_641806.1 lcl|gcdH-XAC1472

42

382

S=320 I=28 E=1.33365e-31

glutaryl-CoA dehydrogenase

XFF4834R

NP_636802.1 lcl|gcdH-XCC1429

42

293

S=297 I=32 E=8.75389e-29

glutaryl-CoA dehydrogenase

XFF4834R

NP_637785.1 lcl|XCC2432

52

219

S=168 I=33 E=3.90685e-13

acyl-CoA dehydrogenase

XFF4834R

NP_642877.1 lcl|XAC2563-XAC2563

52

219

S=164 I=33 E=9.67437e-13

acyl-CoA dehydrogenase

XFF4834R

YP_364493.1 lcl|XCV2762

52

219

S=162 I=33 E=1.96033e-12

acyl-CoA dehydrogenase

XFF4834R

lcl|XALc_1084

47

275

S=148 I=26 E=7.9725e-11

hypothetical acyl-coa dehydrogenase protein

XFF4834R

lcl|XALc_2197

42

378

S=145 I=23 E=2.08022e-10

putative acyl-coa dehydrogenase protein

XFF4834R

YP_364921.1 lcl|fadE-XCV3190

42

378

S=134 I=23 E=4.43786e-09

acyl-CoA dehydrogenase

XFF4834R

NP_643363.1 lcl|fadE-XAC3054

42

378

S=134 I=23 E=5.1022e-09

acyl-CoA dehydrogenase

XFF4834R

NP_638218.1 lcl|fadE-XCC2870

42

378

S=128 I=23 E=2.15046e-08

acyl-CoA dehydrogenase

Iprscan IPR013786 [G3DSA:1.10.540.10]

7

125

Acyl-CoA dehydrogenase/oxidase, N-terminal

Iprscan IPR006091 [G3DSA:2.40.110.10]

126

231

Acyl-CoA oxidase/dehydrogenase, central domain

Iprscan IPR013764 [G3DSA:1.20.140.10]

235

387

Acyl-CoA oxidase/dehydrogenase, type1/2, C-terminal

Iprscan [PTHR10909:SF10]

81

383

-

Iprscan [PTHR10909]

81

383

-

Iprscan IPR006090 [PF00441]

234

382

Acyl-CoA oxidase/dehydrogenase, type 1

Iprscan IPR006092 [PF02771]

12

123

Acyl-CoA dehydrogenase, N-terminal

Iprscan IPR006091 [PF02770]

127

178

Acyl-CoA oxidase/dehydrogenase, central domain

Iprscan IPR006089 [PS00072]

129

141

Acyl-CoA dehydrogenase, conserved site

Iprscan IPR006089 [PS00073]

341

360

Acyl-CoA dehydrogenase, conserved site

Iprscan [seg]

22

38

-

Iprscan [seg]

251

263

-

Iprscan [seg]

299

311

-

Iprscan IPR009100 [SSF56645]

1

232

Acyl-CoA dehydrogenase/oxidase

Iprscan IPR009075 [SSF47203]

235

386

Acyl-CoA dehydrogenase/oxidase C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LCFMoWMc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

178 hits
swiss-prot

Swiss-Prot ncbi-blastp

135 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

5 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

15 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUdIM92/XFF4834R_chr02380.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUdIM92/XFF4834R_chr02380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUdIM92/XFF4834R_chr02380.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUdIM92/XFF4834R_chr02380.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_3591789_3593039_f3_XFF4834R-XFF4834R_chr31230 XFF4834R_chr31230
XFF4834R_chr31220
XFF4834R_chr31220
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31240
XFF4834R_chr31240
ID XFF4834R_chr_3591789_3593039_f3_XFF4834R-XFF4834R_chr31230
AC XFF4834R_chr31230
LT XFF4834R_chr31230
OR XFF4834R_chr from 3591789 to 3593039 on strand +
DE putative flavin containing amine oxidoreductase
IP Amine oxidase
CL 1.1.4 Amines GO:0009310
EC
GO InterPro
Molecular Function: electron carrier activity (GO:0009055)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20101007)
MW 46340 Da
SQ 416 aa
 
........10........20........30........40........50
| | | | |
MSEGRIAVVGSGIAGLGAAWLLSRRYEVTLFEAADYLGGHTHTHDIDLEG
QRYAVDSGFIVFNPQHYPLLTRMFAELDVAAQPTTMSFSVHDARSGLEYN
AGSLSGLFCQRRNLLSPRFWGMLADLRRFYRQAPAVLHGDERFSTLGVYL
QRHGYSDAFRDQHLVPMASALWSSPSQTILEFPMGQLIGFMANHHMLQLS
GRPQWQVVRGGSNSYVRALRRRWQVIERLSTPVQAIRRTPNGVVLKASRC
EEHFDHVVLACHADDALGLLSDATPAEQHILGGITYQDNDTVLHTDANVL
PRDRRAWAAWNAHVPADPDAACTVSYWMNALQSIASPQPFIVSLNRNHEI
DPGKVLRRMRYRHPVQNAAAVAAQARKADIQGVQHTWFAGAAWGFGFHED
GLRSGVDVAHGLGVHW
XFF4834R

NP_641712.1 lcl|XAC1377-XAC1377

1

416

S=2112 I=96 E=0

dehydrogenase

XFF4834R

YP_363164.1 lcl|XCV1433

1

416

S=2110 I=96 E=0

putative flavin containing amine oxidoreductase

XFF4834R

NP_636705.1 lcl|XCC1331

1

416

S=1898 I=86 E=0

dehydrogenase

XFF4834R

lcl|XALc_2496

5

416

S=1633 I=75 E=0

putative flavin containing amine oxidoreductase protein

pubmed

6

416

S=492 I=30 E=8.84007e-51

Cyclopropane synthase

Pubmed 11997456

 

prodomImg

pubmed

20

414

S=348 I=27 E=2.06611e-33

Amine oxidase LkcE ; Plasmid

Pubmed 12791134,10954087

 

prodomImg

Iprscan [G3DSA:3.50.50.60]

5

412

-

Iprscan IPR002937 [PF01593]

13

261

Amine oxidase

Iprscan [seg]

368

378

-

PD138843

50

216

S=480 I=54 E=1.00942e-50

PD713958

254

409

S=394 I=48 E=3.05574e-40

PDA3F0X6

5

188

S=216 I=30 E=1.17002e-18

PDA1V796

217

253

S=170 I=89 E=3.68298e-13

PDA8J248

145

253

S=113 I=28 E=3.50533e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one gsmgxChu)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUdIM92/XFF4834R_chr31230.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUdIM92/XFF4834R_chr31230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUdIM92/XFF4834R_chr31230.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBUdIM92/XFF4834R_chr31230.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.