Xanthomonas fuscans subsp. fuscans

5 hits

  1. XFF4834R_chr04400XFF4834R_chr_0507356_0508495_f2_XFF4834R-XFF4834R_chr04400XFF4834R_chr04400putative tryptophan 2,3-dioxygenase
  2. XFF4834R_chr16360XFF4834R_chr17640403_1893920_f3_XFF4834R-XFF4834R_chr16360XFF4834R_chr16360probable tryptophan halogenase
  3. XFF4834R_chr29100XFF4834R_chr31610984_3344514_f1_XFF4834R-XFF4834R_chr29100XFF4834R_chr29100putative 3-hydroxyanthranilate 3,4-dioxygenase
  4. XFF4834R_chr29120XFF4834R_chr31640741_3348012_f1_XFF4834R-XFF4834R_chr29120XFF4834R_chr29120Putative kynureninase
  5. XFF4834R_chr29130XFF4834R_chr31660184_3349551_f1_XFF4834R-XFF4834R_chr29130XFF4834R_chr29130probable kynurenine 3-monooxygenase

XFF4834R_chr_0507356_0508495_f2_XFF4834R-XFF4834R_chr04400 XFF4834R_chr04400
XFF4834R_chr_0485
XFF4834R_chr_0485
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr04410
XFF4834R_chr04410
ID XFF4834R_chr_0507356_0508495_f2_XFF4834R-XFF4834R_chr04400
AC XFF4834R_chr04400
LT XFF4834R_chr04400
OR XFF4834R_chr from 507599 to 508495 on strand +
DE putative tryptophan 2,3-dioxygenase
IP Tryptophan 2,3-dioxygenase
CL 1.1.3.8 Tryptophan utilization GO:0006569
EC
GO InterPro
3-dioxygenase activity (GO:0004833)
Biological Process: tryptophan catabolic process to kynurenine (GO:0019441)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120319)
MW 34430.8 Da
SQ 298 aa
 
........10........20........30........40........50
| | | | |
MPVDKNLRDLEPGIHTDLEGRLTYGGYLRLDQLLSAQQPLSEPAHHDEML
FIIQHQTSELWLKLLAHELRAAIAHLQRDEVWQCRKVLARSKQVLRQLTE
QWSVLETLTPSEYMGFRDVLGPSSGFQSLQYRYIEFLLGNKNPQMLQVFA
YDPHGQARLREALEAPSLYEEFLRYLARFGHAIPAHYQARDWTAAHVADD
SLRPVFERIYENTDRYWREYALCEDLVDVETQFQLWRFRHMRTVMRVIGF
KRGTGGSSGVGFLQQALALTFFPELFDVRTSVGLDGRPPQGAPDAAQG
XFF4834R

YP_362209.1 XCV0478

1

298

S=1567 I=99 E=0

tryptophan 2,3-dioxygenase

XFF4834R

NP_635826.1 XCC0432

1

297

S=1516 I=96 E=1.05237e-176

tryptophan 2,3-dioxygenase

XFF4834R

NP_640803.1 XAC0448-XAC0448

1

296

S=1500 I=96 E=1.14632e-174

tryptophan 2,3-dioxygenase

XFF4834R

XALc_2742 XALc_2742

1

285

S=1294 I=86 E=1.03791e-149

probable tryptophan 2,3-dioxygenase protein

XFF4834R

NP_636584.1 XCC1210

220

298

S=135 I=41 E=2.22753e-09

tryptophan 2,3-dioxygenase

pubmed

1

297

S=1516 I=96 E=4.34273e-175

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

Pubmed 17197414

 

prodomImg

pubmed

13

282

S=644 I=48 E=2.14031e-69

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

Pubmed 14700627,17198384

 

prodomImg

pubmed

17

282

S=567 I=44 E=4.26711e-60

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

Pubmed 15066027

 

prodomImg

pubmed

17

191

S=407 I=51 E=1.08636e-40

ORF1 ; Plasmid

Pubmed 11976102,14594853

 

prodomImg

pubmed

24

282

S=396 I=36 E=2.52872e-39

SibP

Pubmed 19270142

 

prodomImg

sp_Pdown

sp|Q3BYF4|T23O_XANC5

1

298

S=1567 I=99 E=0

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

sp_Pdown

sp|Q8PDA8|T23O_XANCP

1

297

S=1516 I=96 E=2.95651e-175

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

sp_Pdown

sp|B0RMW5|T23O_XANCB

1

297

S=1516 I=96 E=2.95651e-175

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

sp_Pdown

sp|Q4UZJ5|T23O_XANC8

1

297

S=1516 I=96 E=2.95651e-175

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

sp_Pdown

sp|Q8PQ80|T23O_XANAC

1

296

S=1500 I=96 E=3.22047e-173

Tryptophan 2,3-dioxygenase EC=1.13.11.11 ; Heme Iron Metal-binding Oxidoreductase catabolism

Iprscan IPR004981 [PTHR10138]

12

291

Tryptophan 2,3-dioxygenase

Iprscan IPR004981 [PF03301]

18

144

Tryptophan 2,3-dioxygenase

Iprscan IPR004981 [PF03301]

208

281

Tryptophan 2,3-dioxygenase

PD563815

86

178

S=249 I=54 E=1.08965e-22

PDA1G0M2

22

83

S=191 I=66 E=1.10235e-15

PD008769

209

276

S=181 I=51 E=1.94124e-14

PDA1V7V4

192

219

S=150 I=96 E=9.71618e-11

PDA8N1O1

274

298

S=126 I=96 E=7.20554e-08

PDA1G6N0

140

191

S=116 I=52 E=1.16295e-06

PDA3B0J5

1

21

S=111 I=100 E=4.85902e-06

PDA8N1R5

136

282

S=102 I=35 E=6.47352e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4YYgYw5W)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

43 hits
swiss-prot

Swiss-Prot ncbi-blastp

110 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr04400.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr04400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr04400.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr04400.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr17640403_1893920_f3_XFF4834R-XFF4834R_chr16360 XFF4834R_chr16360
XFF4834R_chr16350
XFF4834R_chr16350
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr16370
XFF4834R_chr16370
ID XFF4834R_chr17640403_1893920_f3_XFF4834R-XFF4834R_chr16360
AC XFF4834R_chr16360
LT XFF4834R_chr16360
OR XFF4834R_chr from 1892403 to 1893920 on strand +
DE probable tryptophan halogenase
IP Tryptophan halogenase
CL 1.1.3.8 Tryptophan utilization GO:0006569
EC
GO InterPro


Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20110310)
MW 56889.4 Da
SQ 505 aa
 
........10........20........30........40........50
| | | | |
MTQAQIRKVVIAGGGTAGWIAACALSHQFRNLLDITLVESEQIGTVGVGE
STVPPIRTFHRFLQIDEQEFLRAVAGTFKLSISFEHWRRQGERYIHPFGI
TGQSTLVCAFHHLWLESQRRGMPGSFGDYCLETVASRVDRFALHGEPAVN
YAYHLDAALYARFLRARSEACGVKRVEGRIQQVTVQPHSGDVASLVLEDG
QTIEGDLFIDCSGFRGLLIEQTLHTGYEDWSHWLPCDRAVAVQTEALGPP
VPYTRAIAHEAGWRWHIPLQHRVGNGLVFSSKHLSDDEAHAKLLRDVAAP
AVKEPWMVPFRTGRRLKAWNKNVVSLGLASGFIEPLESTSIHLTISAVVR
LLALFPAAGIAPSQVQLFNDVSRAEMEHVRDFVILHYHATQREEPLWQQC
RQMELPESLALRLRAWRERAHAWQGADELFRVDSWTHVLMGQGIAPEQHH
PLTRAFSDHDLRRLLDGIAQPIQHAVQQMPSQQDFIERYCKAGEQVWGMR
SPVPA
XFF4834R

XFF4834R_chr39170 lcl|XFF4834R_chr42380214_4513779_f1_XFF4834R-XFF4834R_chr39170

3

490

S=1211 I=48 E=5.13973e-140

XFF4834R

XFF4834R_chr41410 lcl|XFF4834R_chr_4816198_4817718_f1_XFF4834R-XFF4834R_chr41410

1

492

S=1192 I=48 E=1.08606e-137

XFF4834R

NP_643304.1 lcl|prnA-XAC2995

1

505

S=2480 I=93 E=0

tryptophan halogenase

XFF4834R

YP_364875.1 lcl|XCV3144

1

505

S=2473 I=93 E=0

tryptophan halogenase

XFF4834R

NP_638173.1 lcl|prnA-XCC2825

1

498

S=1862 I=71 E=0

tryptophan halogenase

XFF4834R

lcl|XALc_3150

5

505

S=1783 I=68 E=0

putative tryptophan halogenase protein

XFF4834R

NP_644350.1 lcl|prnA-XAC4051

3

492

S=1223 I=48 E=6.88233e-141

tryptophan halogenase

XFF4834R

NP_639305.1 lcl|prnA-XCC3966

2

490

S=1219 I=48 E=1.84336e-140

tryptophan halogenase

XFF4834R

YP_365872.1 lcl|XCV4141

3

490

S=1215 I=48 E=6.6409e-140

tryptophan halogenase

XFF4834R

lcl|XALc_0046

35

492

S=1207 I=51 E=5.38255e-139

putative tryptophan halogenase protein

XFF4834R

NP_639472.1 lcl|prnA-XCC4133

1

492

S=1202 I=47 E=2.51883e-138

tryptophan halogenase

XFF4834R

YP_366108.1 lcl|XCV4377

1

492

S=1194 I=48 E=2.09566e-137

putative tryptophan halogenase

pubmed

6

401

S=609 I=38 E=6.45578e-65

Tryptophan halogenase

Pubmed 10547442

 

prodomImg

pubmed

6

401

S=587 I=35 E=3.15041e-62

PrnA Tryptophan halogenase

Pubmed 10547442,15960662

 

prodomImg

pubmed

6

401

S=587 I=36 E=3.46752e-62

Tryptophan halogenase

Pubmed 10547442

 

prodomImg

pubmed

5

486

S=584 I=32 E=7.73352e-62

Tryptophan halogenase

Pubmed 10547442

 

prodomImg

pubmed

6

451

S=575 I=34 E=9.44287e-61

Tryptophan 5-halogenase

Pubmed 15850981

 

prodomImg

pubmed

3

405

S=568 I=34 E=6.48517e-60

Putative tryptophan halogenase

Pubmed 16873021

 

prodomImg

pubmed

6

401

S=560 I=36 E=6.20335e-59

Tryptophan halogenase

Pubmed 10547442

 

prodomImg

pubmed

3

407

S=558 I=33 E=8.86897e-59

Halogenase Putative halogenase of tryptophan Putative tryptophan halogenase Tryptophan halogenase

Pubmed 11983340,15743957

 

prodomImg

pubmed

6

401

S=547 I=35 E=2.08251e-57

Tryptophan halogenase PrnA

Pubmed 9172332

 

prodomImg

pubmed

25

408

S=534 I=35 E=8.84678e-56

KtzR

Pubmed 17940045

 

prodomImg

Iprscan IPR006905 [PF04820]

8

458

Tryptophan halogenase

Iprscan [PS51257]

1

23

-

Iprscan [seg]

12

24

-

Iprscan [seg]

409

422

-

PD432396

276

480

S=437 I=44 E=2.64799e-45

PD480889

200

281

S=330 I=73 E=2.06998e-32

PDA1G310

89

191

S=264 I=50 E=2.14782e-24

PD432411

31

85

S=205 I=65 E=2.89725e-17

PDA2F800

481

505

S=138 I=100 E=4.22368e-09

PDA2F801

282

308

S=134 I=96 E=1.08301e-08

PDA9T4L6

151

398

S=116 I=21 E=1.9561e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one QVLlUaA4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr16360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr16360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr16360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr16360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr31610984_3344514_f1_XFF4834R-XFF4834R_chr29100 XFF4834R_chr29100
XFF4834R_chr29090
XFF4834R_chr29090
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29110
XFF4834R_chr29110
ID XFF4834R_chr31610984_3344514_f1_XFF4834R-XFF4834R_chr29100
AC XFF4834R_chr29100
LT XFF4834R_chr29100
OR XFF4834R_chr from 3343984 to 3344514 on strand +
DE putative 3-hydroxyanthranilate 3,4-dioxygenase
IP 3-hydroxyanthranilic acid dioxygenase
CL 1.1.3.8 Tryptophan utilization GO:0006569
EC
GO InterPro
4-dioxygenase activity (GO:0000334)
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: iron ion binding (GO:0005506)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 20187 Da
SQ 176 aa
 
........10........20........30........40........50
| | | | |
MLIPPINLHAWIEEHRHLLKPPVGNKCIQQDGFIIMVVGGPNARTDYHYD
EGPEWFFQLEGEMVLKVQDEGVARDIPIRAGEVFLLPPKVPHSPQRAAGS
IGLVIERERLSTEQDGLQWYCPQCNHKLYEAMFPLKNIETDFPPVFDRFY
RSLALRTCSQCGHLHPAPERYATVED
XFF4834R

YP_363376.1 lcl|XCV1645

1

176

S=931 I=99 E=3.66263e-106

3-hydroxyanthranilate 3,4-dioxygenase

XFF4834R

NP_641935.1 lcl|haaO-XAC1603

1

175

S=911 I=98 E=1.07794e-103

3-hydroxyanthranilate 3,4-dioxygenase

XFF4834R

NP_636926.1 lcl|haaO-XCC1555

1

175

S=889 I=92 E=5.68973e-101

3-hydroxyanthranilate 3,4-dioxygenase

XFF4834R

lcl|XALc_1752

1

165

S=676 I=73 E=3.7607e-75

putative 3-hydroxyanthranilate 3,4-dioxygenase protein

pubmed

1

164

S=428 I=46 E=1.34939e-43

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Cytoplasm Iron Metal-binding Oxidoreductase Pyridine nucleotide biosynthesis

Pubmed 18460219

 

prodomImg

pubmed

5

167

S=421 I=48 E=1.06547e-42

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Iron Metal-binding Oxidoreductase

Pubmed 12620844

 

prodomImg

pubmed

5

167

S=414 I=50 E=7.00528e-42

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Iron Metal-binding Oxidoreductase Plasmid

Pubmed 15909977,15909978

 

prodomImg

pubmed

6

157

S=409 I=49 E=2.70604e-41

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Cytoplasm Iron Metal-binding Oxidoreductase Phosphoprotein Pyridine nucleotide biosynthesis

Pubmed 18630941

 

prodomImg

pubmed

6

157

S=402 I=49 E=1.77918e-40

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Alternative splicing Cytoplasm Iron Metal-binding Oxidoreductase Polymorphism Pyridine nucle

Pubmed 7514594

 

prodomImg

sp_Pdown

sp|Q3BV37|3HAO_XANC5

1

176

S=931 I=99 E=9.26316e-105

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Iron Metal-binding Oxidoreductase

sp_Pdown

sp|Q8PM31|3HAO_XANAC

1

175

S=911 I=98 E=2.72622e-102

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Iron Metal-binding Oxidoreductase

sp_Pdown

sp|Q5H043|3HAO_XANOR

1

176

S=899 I=94 E=7.35969e-101

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Iron Metal-binding Oxidoreductase

sp_Pdown

sp|Q2P320|3HAO_XANOM

1

176

S=899 I=94 E=7.35969e-101

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Iron Metal-binding Oxidoreductase

sp_Pdown

sp|Q8PAD0|3HAO_XANCP

1

175

S=889 I=92 E=1.43899e-99

3-hydroxyanthranilate 3,4-dioxygenase EC=1.13.11.6 ; Iron Metal-binding Oxidoreductase

Iprscan [MF_00825]

1

170

-

Iprscan IPR010329 [PF06052]

3

150

3-hydroxyanthranilic acid dioxygenase

Iprscan IPR010329 [TIGR03037]

6

163

3-hydroxyanthranilic acid dioxygenase

PD580603

1

167

S=538 I=61 E=1.1475e-57

Iprscan IPR011051 [SSF51182]

3

139

Cupin, RmlC-type

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eQmXniBA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

9 hits
swiss-prot

Swiss-Prot ncbi-blastp

56 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29100.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29100.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29100.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr31640741_3348012_f1_XFF4834R-XFF4834R_chr29120 XFF4834R_chr29120
XFF4834R_chr29110
XFF4834R_chr29110
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29130
XFF4834R_chr29130
ID XFF4834R_chr31640741_3348012_f1_XFF4834R-XFF4834R_chr29120
AC XFF4834R_chr29120
LT XFF4834R_chr29120
OR XFF4834R_chr from 3346741 to 3348012 on strand +
DE Putative kynureninase
IP Aminotransferase, class V/Cysteine desulfurase; Kynureninase; Pyridoxal phosphate-dependent transferase, major region, subdomain 1
CL 1.1.3.8 Tryptophan utilization GO:0006569
EC
GO InterPro
Biological Process: tryptophan catabolic process (GO:0006569)
Biological Process: metabolic process (GO:0008152)
Biological Process: NAD biosynthetic process (GO:0009435)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: pyridoxal phosphate binding (GO:0030170)
Molecular Function: kynureninase activity (GO:0030429)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 45862.8 Da
SQ 423 aa
 
........10........20........30........40........50
| | | | |
MTDPLSRAHAAALDAADPLRNLRDAFVFPQHGDGDQTYFVGNSLGLQPRA
ARAMVDEVLDQWGALAVEGHFTGPTQWLTYHQLVRDALARVVGAQPGEVV
AMNTLSVNLHLMMASFYRPTAERGAILIEAGAFPSDRHAVESQLRLHGLD
PATHLIEVEADEPNGTVSMSAIAEAIAQHGPRLALVLWPGIQYRTGQAFD
LAEIVRLARAQGAAVGFDLAHAVGNLPLTLHDDGADFAVWCHYKYLNAGP
GAVGGCFVHARHATSDLPRMAGWWGHEQQTRFRMDPQFVPSPGAEGWQLS
NPPVLALAPLRASLALFDQAGMAALRAKSKQLTGHLEQLIHARVPQVLQI
VTPVEPARRGCQLSLRVAGGRAQGRALFEHLHAAGVLGDWREPDVIRIAP
VPLYNRFSDLHTFVEQVQAWAAA
XFF4834R

XFF4834R_chr00700 lcl|XFF4834R_chr00700474_0083655_f1_XFF4834R-XFF4834R_chr00700

77

290

S=99 I=26 E=2.10729e-05

XFF4834R

XFF4834R_chr00700 lcl|XFF4834R_chr00700474_0083655_f1_XFF4834R-XFF4834R_chr00700

77

290

S=99 I=26 E=2.10729e-05

pubmed

26

413

S=1019 I=47 E=1.03989e-114

Kynureninase EC=3.7.1.3 ; Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 17592475

 

prodomImg

pubmed

26

413

S=979 I=45 E=9.16566e-110

Kynureninase EC=3.7.1.3 ; Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 17107561

 

prodomImg

pubmed

32

419

S=880 I=43 E=7.89274e-98

Kynureninase EC=3.7.1.3 ; Cytoplasm Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 17615350

 

prodomImg

pubmed

32

418

S=871 I=46 E=9.47069e-97

Kynureninase EC=3.7.1.3 ; Cytoplasm Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 18273011

 

prodomImg

pubmed

31

414

S=854 I=45 E=1.03162e-94

Kynureninase 1 EC=3.7.1.3 ; Cytoplasm Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 18024570

 

prodomImg

pubmed

31

413

S=835 I=43 E=2.25726e-92

Kynureninase EC=3.7.1.3 ; Acetylation Cytoplasm Disease mutation Hydrolase Polymorphism Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 8706755,9180257

 

prodomImg

pubmed

33

419

S=827 I=42 E=2.17807e-91

Kynureninase EC=3.7.1.3 ; Acetylation Cytoplasm Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 7578221,9180257

 

prodomImg

pubmed

38

415

S=785 I=44 E=2.4937e-86

Kynureninase 2 EC=3.7.1.3 ; Cytoplasm Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 17259976

 

prodomImg

pubmed

32

414

S=770 I=42 E=1.48838e-84

Kynureninase 2 EC=3.7.1.3 ; Cytoplasm Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 18024570

 

prodomImg

pubmed

33

418

S=760 I=40 E=2.59829e-83

Kynureninase EC=3.7.1.3 ; Cytoplasm Hydrolase Nucleus Pyridine nucleotide biosynthesis Pyridoxal phosphate

Pubmed 12062417

 

prodomImg

sp_Pdown

sp|Q8PM33|KYNU_XANAC

1

423

S=1963 I=90 E=0

Kynureninase EC=3.7.1.3 ; Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

sp_Pdown

sp|Q3BV40|KYNU_XANC5

1

423

S=1948 I=89 E=0

Kynureninase EC=3.7.1.3 ; Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

sp_Pdown

sp|B2SIT8|KYNU_XANOP

1

423

S=1882 I=86 E=0

Kynureninase EC=3.7.1.3 ; Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

sp_Pdown

sp|Q5H039|KYNU_XANOR

1

423

S=1874 I=86 E=0

Kynureninase EC=3.7.1.3 ; Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

sp_Pdown

sp|Q2P317|KYNU_XANOM

1

423

S=1873 I=86 E=0

Kynureninase EC=3.7.1.3 ; Hydrolase Pyridine nucleotide biosynthesis Pyridoxal phosphate

Iprscan IPR015421 [G3DSA:3.40.640.10]

48

320

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan IPR010111 [PTHR14084]

3

423

Kynureninase

Iprscan IPR000192 [PF00266]

75

371

Aminotransferase, class V/Cysteine desulfurase

Iprscan IPR010111 [TIGR01814]

10

422

Kynureninase

Iprscan [seg]

7

25

-

Iprscan [seg]

302

316

-

PD336651

38

139

S=232 I=47 E=1.43696e-20

PD881955

204

273

S=192 I=54 E=1.02741e-15

PDA1G0B0

350

418

S=160 I=51 E=7.35201e-12

PD906423

141

201

S=158 I=52 E=1.31857e-11

PD155032

278

343

S=110 I=37 E=7.9124e-06

Iprscan IPR015424 [SSF53383]

5

420

Pyridoxal phosphate-dependent transferase, major domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KmhhHMpv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

19 hits
swiss-prot

Swiss-Prot ncbi-blastp

85 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29120.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29120.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr31660184_3349551_f1_XFF4834R-XFF4834R_chr29130 XFF4834R_chr29130
XFF4834R_chr29120
XFF4834R_chr29120
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29140
XFF4834R_chr29140
ID XFF4834R_chr31660184_3349551_f1_XFF4834R-XFF4834R_chr29130
AC XFF4834R_chr29130
LT XFF4834R_chr29130
OR XFF4834R_chr from 3348184 to 3349551 on strand +
DE probable kynurenine 3-monooxygenase
IP FAD dependent oxidoreductase
CL 1.1.3.8 Tryptophan utilization GO:0006569
EC
GO InterPro
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN pubmed : Kynurenine 3-monooxygenase (KMO) is an NADPH-dependent flavoprotein hydroxylase that catalyzes the conversion of l-Kynurenine (L-Kyn) to 3-hydroxykynurenine (3OHKyn). The reaction is central to the tryptophan degradative pathway and takes place within microglial cells defining cellular concentrations of the N-methyl-d-aspatate (NMDA) receptor agonist quinolinate and antagonist kynurenate. The Pseudomonas siderophore quinolobactin is synthesized from xanthurenic acid, an intermediate of the kynurenine pathway. pyridine nucleotide biosynthetic process Cofactor biosynthesis; NAD(+) biosynthesis; quinolinate from L-kynurenine: step 1/3. Siderophore biosynthesis; quinolobactin biosynthesis.
CC COG: [CH] Energy production and conversion;Coenzyme transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 50810.1 Da
SQ 455 aa
 
........10........20........30........40........50
| | | | |
MSPVSPRSLTLIGAGLAGCLLAILLSRRGWQVTVYERRGDPRIKGYESGR
SINLALAERGRHALRQAGAEDAVMAKAVMMRGRMVHPLVGQPQLQRYGRD
DSEVIWSIHRAALNVALLDLAEQAGARVHFYRRLHTVDFDAGYARFIDDR
DDQPHEIHFQSLIGSDGAGSALRAAMQRKSPLGERTEFLDHSYKELEIPP
QPGGGFRIEGNALHIWPRGRYMCIALPNDGGTFTVTLFLPNAGEPSFATT
RTGDEAFALFARDFPDALPLIPQLKEHWEEHPPGLLGTLTLDRWHLDGRA
LLIGDAAHAMVPFHGQGMNCAFEDCVALADQLDAHDDLASAFAAFEAARR
DDAAAIQQMALENYLEMRDRVDDPDFLLQRELEQQLQARWPTRFVPHYTM
VTFLRTRYSIALARSEIQREILVQATRGHSDLSRIDWAALEAVVHARLEP
LDGAH
XFF4834R

NP_641932.1 lcl|XAC1600-XAC1600

1

455

S=2046 I=87 E=0

kynurenine 3-monooxygenase

XFF4834R

YP_363372.1 lcl|XCV1641

1

455

S=2019 I=85 E=0

putative kynurenine 3-monooxygenase

XFF4834R

NP_636923.1 lcl|XCC1552

2

455

S=1878 I=79 E=0

kynurenine 3-monooxygenase

XFF4834R

lcl|XALc_1755

5

454

S=1654 I=70 E=0

putative kynurenine 3-monooxygenase oxidoreductase protein

pubmed

26

452

S=969 I=49 E=1.50384e-108

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

Pubmed 15066027,16973376

 

prodomImg

pubmed

27

427

S=646 I=36 E=2.11776e-69

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

Pubmed 17592475

 

prodomImg

pubmed

27

427

S=633 I=36 E=7.49129e-68

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

Pubmed 17107561

 

prodomImg

pubmed

26

422

S=628 I=35 E=2.58369e-67

Kynurenine 3-monooxygenase EC=1.14.13.9 ; Alternative splicing FAD Flavoprotein Membrane Mitochondrion outer NADP Oxidoreductase Phosphoprotein P

Pubmed 9237672,10672018

 

prodomImg

pubmed

27

425

S=621 I=35 E=2.16844e-66

Kynurenine 3-monooxygenase EC=1.14.13.9 ; Alternative splicing FAD Flavoprotein Membrane Mitochondrion NADP Oxidoreductase Pyridine nucleotide bi

Pubmed 12974953,17510324

 

prodomImg

pubmed

27

422

S=617 I=37 E=6.33706e-66

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

Pubmed 14700627

 

prodomImg

pubmed

26

422

S=614 I=36 E=1.48924e-65

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein Membrane Mitochondrion outer NADP Oxidoreductase Phosphoprotein Pyridine nucleotide biosyn

Pubmed 1332540

 

prodomImg

pubmed

26

425

S=614 I=36 E=1.54209e-65

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein Membrane Mitochondrion outer NADP Oxidoreductase Phosphoprotein Pyridine nucleotide biosynthesis

Pubmed 10721109

 

prodomImg

pubmed

27

430

S=591 I=35 E=9.19643e-63

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein Membrane Mitochondrion NADP Oxidoreductase Pyridine nucleotide biosynthesis Transmembrane

Pubmed 12364791

 

prodomImg

pubmed

27

454

S=588 I=34 E=1.86349e-62

Kynurenine 3-monooxygenase

Pubmed 12230548

 

prodomImg

sp_Pdown

sp|Q8PM34|KMO_XANAC

1

455

S=2046 I=87 E=0

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

sp_Pdown

sp|Q3BV41|KMO_XANC5

1

455

S=2019 I=85 E=0

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

sp_Pdown

sp|Q2P316|KMO_XANOM

1

455

S=1989 I=84 E=0

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

sp_Pdown

sp|Q5H038|KMO_XANOR

1

455

S=1987 I=84 E=0

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

sp_Pdown

sp|B2SIT6|KMO_XANOP

1

455

S=1987 I=84 E=0

Kynurenine 3-monooxygenase EC=1.14.13.9 ; FAD Flavoprotein NADP Oxidoreductase Pyridine nucleotide biosynthesis

PDA1S8A0

44

104

S=307 I=98 E=1.12717e-29

PD598279

364

446

S=239 I=58 E=2.06131e-21

PDA1K7F9

227

285

S=186 I=62 E=4.61437e-15

PD014022

172

226

S=135 I=48 E=8.16292e-09

PDA4A449

30

80

S=132 I=55 E=2.0038e-08

PDA1H164

206

240

S=119 I=60 E=7.15027e-07

PDA245E0

26

74

S=108 I=51 E=1.33841e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jcUxMvgx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

66 hits
swiss-prot

Swiss-Prot ncbi-blastp

54 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29130.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29130.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGumfE6/XFF4834R_chr29130.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.