Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr10280tdhXFF4834R_chr10280L-threonine 3-dehydrogenase

tdh XFF4834R_chr10280
XFF4834R_chr10270
XFF4834R_chr10270
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10290
XFF4834R_chr10290
ID tdh
AC XFF4834R_chr10280
LT XFF4834R_chr10280
OR XFF4834R_chr from 1163248 to 1164270 on strand -
DE L-threonine 3-dehydrogenase
IP Alcohol dehydrogenase superfamily, zinc-containing; Alcohol dehydrogenase, zinc-containing, conserved site; GroES-like; NAD(P)-binding domain;
CL 1.1.3.7 Threonine catabolism GO:0006567
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: threonine catabolic process (GO:0006567)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: L-threonine 3-dehydrogenase activity (GO:0008743)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
Molecular Function: zinc ion binding (GO:0008270)

Curated
PM
AN
CC COG: [ER] Amino acid transport and metabolism;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20130514)
MW 37111.9 Da
SQ 340 aa
 
........10........20........30........40........50
| | | | |
MKALVKREANKGIWLEQVPVPTPGPNEVLIKLEKTAICGTDLHIYLWDEW
SQRTIKPGLTIGHEFVGRVAELGSAVTGYQVGQRVSAEGHIVCGHCRNCR
GGRPHLCPNTVGIGVNVNGAFAEYMVMPASNLWPIPDQIPSELAAFFDPY
GNAAHCALEFDVIGEDVLITGAGPIGIIAAGICKHIGARNVVVTDVNDFR
LKLAADMGATRVVNVSKTSLKDVMADLHMEGFDVGLEMSGNPRAFNDMLD
CMYHGGKIAMLGIMPRGAGCDWDKIIFKGLTVQGIYGRKMYETWYKMTQL
VLSGFPLQKVLTHQLPIDDFQKGFDLMEEGKAGKVVLSWN
Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KmnZcEdW)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

433 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBU4soLn/XFF4834R_chr10280.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBU4soLn/XFF4834R_chr10280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBU4soLn/XFF4834R_chr10280.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBU4soLn/XFF4834R_chr10280.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.