Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr37780putAXFF4834R_chr37780putative fused DNA-binding transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

putA XFF4834R_chr37780
XFF4834R_chr_4021
XFF4834R_chr_4021
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4023
XFF4834R_chr_4023
ID putA
AC XFF4834R_chr37780
LT XFF4834R_chr37780
OR XFF4834R_chr from 4364106 to 4367306 on strand +
DE putative fused DNA-binding transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase
IP Proline dehydrogenase; Delta-1-pyrroline-5-carboxylate dehydrogenase 3; Aldehyde dehydrogenase, conserved site
CL 1.1.3.6 Proline utilization GO:0006562
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: proline catabolic process (GO:0006562)
Biological Process: metabolic process (GO:0008152)
Biological Process: proline biosynthetic process (GO:0006561)
Biological Process: glutamate biosynthetic process (GO:0006537)
Molecular Function: proline dehydrogenase activity (GO:0004657)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: 1-pyrroline-5-carboxylate dehydrogenase activity (GO:0003842)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: acur
CC STATUS: curated by opruvost (20100504)
MW 114647.4 Da
SQ 1066 aa
 
........10........20........30........40........50
| | | | |
MNAQLDPLASTSVARPLLGPELPAAPGALRAAITAAWLKDETEHVRELLD
QARLPAAEQAKVQAIAADLVTRVRARAQDQGAIEAFMRQYDLGSEEGVLL
MCVAEALLRIPDQDTADKLIRDKLGDADWKKHMGGSDSVLVNASTWGLML
TGRLVQLNDLTRADVPGAFKRLIGRVGEPVIRLAVRQAMKIMGHQFVMGR
TIGEALSRSRKGDNADYRYSFDMLGEGALTMKDAQRYLQAYRDAIHAIGR
SGSFVGTDVFAAPSISIKLSALYPRYEHAKRARVMAELVPGVLELAQLAK
SYGIGYTVDAEEADRLELSLDIIEATFSDPSLDGWEGYGLAVQAYQKRTP
YTIDFLADLARRVGRRIPVRLVKGAYWDAEIKRAQIEGHPGYPVFTRKQN
TDVSYLACARRMFAHSDALYPMFATHNAQTIAAVRAIAAGKTYEHQKLHG
MGDDLYAEVIPADRLDLPCRVYRPVGSHEDLLPYLVRRLLENGANSSFVN
RITDEDVAIEDLIRDPVEAVTSFTSIPHPKIPLPADLLRSQNQNRKNSMG
ANLANDNDLRQLAEQLNAAIKPWKATPLVPGALISTPSQAVLNPADRRET
VGQWHPADPDTVQKSLASAAAAQPAWNRTPAASRATILEHAADLLETRMS
EFMAICVKEAGKTLPDAVAEVREAVDFLRYYAGQARAQFGAPERLPGPTG
ESNELQLHGRGVFVCISPWNFPLAIFLGQVAAALAAGNTVIAKPAEQTNL
VGFAAVKLLHEAGVPEAAMQFLPGDGATVGAALTNDPRVAGVAFTGSTET
ARIINRTLAARDAAIGVLIAETGGQNAFIADSSSLPEAVVKDAISSAFIS
AGQRCSAARVLFVQDDIAEKVMTMLAGAMGELKIGDPGLLSTDVGPVIDA
DALKILDDHAARMDRQARLIGSTALDGSTAHGSFFAPRAYELTSLSQLQR
EIFGPVLHVIRWKADQLDAVIEQINATGYGLTLGVHSRIDETIDRITSRV
AVGNVYVNRNQIGAVVGVQPFGGQGLSGTGPKAGGPHYLLRFATEKVVTV
NTTAAGGNASLLTLGD
XFF4834R

XFF4834R_chr07270 lcl|betB-XFF4834R_chr07270

591

1034

S=408 I=31 E=2.05144e-42

betaine aldehyde dehydrogenase, NAD-dependent

XFF4834R

XFF4834R_chr08850 lcl|XFF4834R_chr09420449_1027918_r3_XFF4834R-XFF4834R_chr08850

626

1023

S=395 I=32 E=9.76071e-41

XFF4834R

XFF4834R_chr01250 lcl|aldB-XFF4834R_chr01250

626

1030

S=369 I=32 E=1.18982e-37

aldehyde dehydrogenase B

XFF4834R

XFF4834R_chr19380 lcl|XFF4834R_chr20740024_2218556_r2_XFF4834R-XFF4834R_chr19380

592

1034

S=361 I=29 E=1.16828e-36

XFF4834R

XFF4834R_chr24530 lcl|sad-XFF4834R_chr24530

626

1050

S=332 I=29 E=3.84778e-33

predicted aldehyde dehydrogenase

XFF4834R

XFF4834R_chr31940 lcl|XFF4834R_chr34480466_3665971_r3_XFF4834R-XFF4834R_chr31940

578

1008

S=321 I=28 E=8.64953e-32

XFF4834R

XFF4834R_chr41130 lcl|XFF4834R_chr_4776385_4777803_r1_XFF4834R-XFF4834R_chr41130

700

1008

S=216 I=32 E=4.48824e-19

XFF4834R

XFF4834R_chr12540 lcl|XFF4834R_chr13190488_1421068_f2_XFF4834R-XFF4834R_chr12540

692

975

S=133 I=27 E=5.29883e-09

XFF4834R

XFF4834R_chr07270 lcl|betB-XFF4834R_chr07270

591

1034

S=408 I=31 E=2.05144e-42

betaine aldehyde dehydrogenase, NAD-dependent

XFF4834R

XFF4834R_chr08850 lcl|XFF4834R_chr09420449_1027918_r3_XFF4834R-XFF4834R_chr08850

626

1023

S=395 I=32 E=9.76071e-41

XFF4834R

NP_644196.1 lcl|putA-XAC3890

1

1066

S=5268 I=94 E=0

bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

XFF4834R

YP_365739.1 lcl|putA-XCV4008

1

1066

S=5220 I=93 E=0

bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

XFF4834R

NP_639180.1 lcl|putA-XCC3835

1

1066

S=5068 I=90 E=0

bifunctional proline dehydrogenase/pyrroline-5- carboxylate dehydrogenase

XFF4834R

lcl|putA-XALc_0398

37

1066

S=4755 I=87 E=0

probable bifunctional protein puta [includes: proline dehydrogenase and delta-1-pyrroline-5-carboxylate]

XFF4834R

lcl|XALc_3040

634

1050

S=429 I=34 E=2.37557e-44

putative aldehyde dehydrogenase protein

XFF4834R

NP_635749.1 lcl|xylC-XCC0354

607

1036

S=417 I=32 E=7.18274e-43

benzaldehyde dehydrogenase II

XFF4834R

NP_640710.1 lcl|xylC-XAC0354

626

1036

S=413 I=33 E=2.15472e-42

benzaldehyde dehydrogenase II

XFF4834R

YP_362506.1 lcl|betB-XCV0775

591

1034

S=407 I=31 E=1.09064e-41

betaine aldehyde dehydrogenase

XFF4834R

NP_641072.1 lcl|betB-XAC0719

591

1034

S=396 I=31 E=2.36764e-40

betaine aldehyde dehydrogenase

XFF4834R

YP_362098.1 lcl|XCV0367

629

1052

S=396 I=32 E=2.76996e-40

putative aldehyde dehydrogenase

pubmed

72

1050

S=2648 I=52 E=0

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

pubmed

567

822

S=359 I=35 E=3.26938e-34

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

pubmed

72

1050

S=2640 I=52 E=0

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

pubmed

567

822

S=359 I=35 E=2.69875e-34

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

pubmed

72

1050

S=2638 I=52 E=0

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

pubmed

567

822

S=364 I=35 E=8.31734e-35

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

pubmed

72

1050

S=2630 I=52 E=0

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

pubmed

567

822

S=359 I=35 E=3.02265e-34

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

pubmed

72

1050

S=2630 I=52 E=0

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

pubmed

567

822

S=361 I=35 E=1.76045e-34

Bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase

Pubmed 19187160

 

prodomImg

sp_Pdown

sp|P09546|PUTA_ECOLI

37

1042

S=2552 I=51 E=0

Bifunctional protein putA EC=1.5.99.8 EC=1.5.1.12 ; DNA-binding FAD Flavoprotein Multifunctional enzyme NAD Oxidoreductase Proline metabolism R

sp_Pdown

sp|O52485|PUTA_KLEAE

37

1046

S=2542 I=51 E=0

Bifunctional protein putA EC=1.5.99.8 EC=1.5.1.12 ; DNA-binding FAD Flavoprotein Multifunctional enzyme NAD Oxidoreductase Proline metabolism Repressor Transcrip

sp_Pdown

sp|P10503|PUTA_SALTY

37

1053

S=2513 I=50 E=0

Bifunctional protein putA EC=1.5.99.8 EC=1.5.1.12 ; DNA-binding FAD Flavoprotein Multifunctional enzyme NAD Oxidoreductase Proline metabolism

sp_Pdown

sp|P95629|PUTA_RHIME

37

1044

S=2228 I=50 E=0

Bifunctional protein putA EC=1.5.99.8 EC=1.5.1.12 ; DNA-binding FAD Flavoprotein Multifunctional enzyme NAD Oxidoreductase Proline metabolism

sp_Pdown

sp|Q5L3K8|ROCA_GEOKA

577

1049

S=725 I=37 E=1.02149e-78

1-pyrroline-5-carboxylate dehydrogenase EC=1.5.1.12 ; NAD Oxidoreductase

PDA979U4

555

789

S=302 I=33 E=6.64904e-29

PD008672

263

378

S=297 I=59 E=2.75397e-28

PDA0V856

177

253

S=233 I=59 E=1.46026e-20

PD839651

570

611

S=214 I=93 E=3.39621e-18

PD344745

37

127

S=203 I=45 E=7.05827e-17

PD008671

448

499

S=203 I=69 E=7.37278e-17

PDA1F8I1

379

427

S=197 I=71 E=3.60392e-16

PDA867L2

734

824

S=193 I=46 E=1.10977e-15

PDA185E9

818

867

S=186 I=74 E=8.10135e-15

PD616240

1013

1052

S=183 I=83 E=1.98869e-14

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one fdjC7vpz)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

8 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdfdh9Q/XFF4834R_chr37780.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdfdh9Q/XFF4834R_chr37780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdfdh9Q/XFF4834R_chr37780.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBdfdh9Q/XFF4834R_chr37780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.