Xanthomonas fuscans subsp. fuscans

6 hits

  1. XFF4834R_chr15720gcvTXFF4834R_chr15720glycine cleavage system aminomethyltransferase T
  2. XFF4834R_chr15730gcvHXFF4834R_chr15730glycine cleavage system protein H
  3. XFF4834R_chr21780XFF4834R_chr23750166_2527038_r1_XFF4834R-XFF4834R_chr21780XFF4834R_chr21780putative Glycine cleavage T-protein
  4. XFF4834R_chr29820XFF4834R_chr_3425781_3427223_f3_XFF4834R-XFF4834R_chr29820XFF4834R_chr29820probable dihydrolipoamide dehydrogenase
  5. XFF4834R_chr33260gcvPXFF4834R_chr33260probable glycine decarboxylase
  6. XFF4834R_chr35550lpdAXFF4834R_chr35550probable dihydrolipoamide dehydrogenase (e3 component of 2-oxoglutarate dehydrogenase complex)

gcvT XFF4834R_chr15720
XFF4834R_chr_4656
XFF4834R_chr_4656
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15730
XFF4834R_chr15730
ID gcvT
AC XFF4834R_chr15720
LT XFF4834R_chr15720
OR XFF4834R_chr from 1819552 to 1820661 on strand +
DE glycine cleavage system aminomethyltransferase T
IP Glycine cleavage T-protein, N-terminal; Glycine cleavage T-protein, C-terminal barrel
CL 1.1.3.5 Glycine cleavage GO:0019464
EC
GO InterPro
Biological Process: glycine catabolic process (GO:0006546)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: aminomethyltransferase activity (GO:0004047)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 40332.8 Da
SQ 369 aa
 
........10........20........30........40........50
| | | | |
MTQKTILNDTHRALGAKMVDFGGWDMPIHYGSQLDEHHQVRRDAGMFDVS
HMTVVDLHGARVREFLRYLLANSVDKLKVAGKALYTCMLNPQGGVIDDLI
VYYMAEDFFRLVVNAATREKDLQWIGEQAARFDVRVEERSDFAMIAVQGP
SARTKVIDLLDPADTAAASKLGRFAALQTRSRDGIELFLARTGYTGEDGF
EIVLPQQAAVAFWNALLAQGVKPAGLGARDTLRLEAGMNLYGQDMDDGVT
PYEAGLAWTIALDEGRDFIGRSVLEYQKAQGAPRQLIGVVMDEKGVLRHG
QTVLTASGEGEILSGTFSPTLGKAIAFARVPAGSIEPLRVDIRGKQVPLR
AVKFPFVRDGQAQPGVLGD
Hamap GCST_MF_00259 raw_score=8992 norm_score=45.769

Aminomethyltransferase [gcvT].

X.species

NP_643370.1 lcl|gcvT-XAC3061

1

369

S=1906 I=99 E=0

glycine cleavage system aminomethyltransferase T

X.species

YP_364927.1 lcl|gcvT-XCV3196

1

369

S=1904 I=98 E=0

glycine cleavage system aminomethyltransferase T

X.species

NP_638225.1 lcl|gcvT-XCC2877

1

368

S=1792 I=92 E=0

glycine cleavage system aminomethyltransferase T

X.species

lcl|gcvT-XALc_2205

1

368

S=1584 I=82 E=0

putative glycine cleavage system t protein, aminomethyltransferase

pubmed

1

362

S=1047 I=58 E=3.76351e-118

Aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

Pubmed 8219277,8375392

 

prodomImg

pubmed

1

358

S=681 I=42 E=9.54855e-74

Aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

Pubmed 19014707

 

prodomImg

pubmed

3

358

S=612 I=38 E=2.11541e-65

Aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

Pubmed 17592475

 

prodomImg

pubmed

3

356

S=612 I=38 E=2.19049e-65

Aminomethyltransferase ; Aminotransferase

Pubmed 15870321

 

prodomImg

pubmed

3

356

S=592 I=39 E=5.75596e-63

Aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

Pubmed 18524787

 

prodomImg

pubmed

3

364

S=558 I=39 E=6.25939e-59

Os04g0623800 protein OSJNBa0053K19.11 protein

Pubmed 16758443

 

prodomImg

pubmed

3

364

S=535 I=38 E=3.89917e-56

Aminomethyltransferase, mitochondrial EC=2.1.2.10 ; Aminotransferase Mitochondrion Transit peptide

Pubmed 8223576,7766903

 

prodomImg

pubmed

3

364

S=532 I=38 E=1.0263e-55

Aminomethyltransferase, mitochondrial EC=2.1.2.10 ; Aminotransferase Mitochondrion Transit peptide

Pubmed 7766903

 

prodomImg

pubmed

1

356

S=527 I=37 E=3.57063e-55

Probable aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

Pubmed 18790866

 

prodomImg

pubmed

3

364

S=519 I=38 E=4.06611e-54

Aminomethyltransferase, mitochondrial EC=2.1.2.10 ; Aminotransferase Mitochondrion Transit peptide

Pubmed 8165246

 

prodomImg

sp

1

369

S=1906 I=99 E=0

Aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

 

prodomImg

sp

1

369

S=1904 I=98 E=0

Aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

 

prodomImg

sp

1

369

S=1832 I=95 E=0

Aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

 

prodomImg

sp

1

369

S=1832 I=95 E=0

Aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

 

prodomImg

sp

1

369

S=1825 I=95 E=0

Aminomethyltransferase EC=2.1.2.10 ; Aminotransferase

 

prodomImg

Iprscan [MF_00259]

1

359

-

Iprscan IPR006223 [PIRSF006487]

1

365

Glycine cleavage system T protein

Iprscan IPR006222 [PF01571]

46

259

Glycine cleavage T-protein, N-terminal

Iprscan IPR013977 [PF08669]

266

354

Glycine cleavage T-protein, C-terminal barrel

Iprscan IPR006223 [TIGR00528]

2

359

Glycine cleavage system T protein

PD003737

7

282

S=600 I=49 E=3.10341e-65

PDA8U4U0

9

184

S=232 I=34 E=1.17588e-20

PDA1L1F0

331

367

S=172 I=92 E=2.67635e-13

PD280855

262

336

S=144 I=47 E=5.45692e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RDDgUqGl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

36 hits
swiss-prot

Swiss-Prot ncbi-blastp

310 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr15720.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr15720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr15720.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr15720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
gcvH XFF4834R_chr15730
XFF4834R_chr15720
XFF4834R_chr15720
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15740
XFF4834R_chr15740
ID gcvH
AC XFF4834R_chr15730
LT XFF4834R_chr15730
OR XFF4834R_chr from 1820805 to 1821200 on strand +
DE glycine cleavage system protein H
IP Glycine cleavage H-protein; 2-oxo acid dehydrogenase, lipoyl-binding site
CL 1.1.3.5 Glycine cleavage GO:0019464
EC
GO InterPro
Biological Process: glycine catabolic process (GO:0006546)
Cellular Component: glycine cleavage complex (GO:0005960)
Cellular Component: mitochondrion (GO:0005739)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 14101.3 Da
SQ 131 aa
 
........10........20........30........40........50
| | | | |
MSEIPGDLKFLKSHEWARVESNGRVTVGISDHAQGLLGDLVYVELPGVGD
TVQVGNGAAVVESVKAASDVYSPVSGTVVEVNSALSDKPETINEDAYGEG
WIFVVEIDDKEQLNDLLDPDDYAELLEDDDH
Hamap GCSH_MF_00272 raw_score=3207 norm_score=30.839

Glycine cleavage system H protein [gcvH].

X.species

NP_643369.1 lcl|gcvH-XAC3060

1

131

S=663 I=100 E=6.60286e-74

glycine cleavage system protein H

X.species

YP_364926.1 lcl|gcvH-XCV3195

1

131

S=657 I=99 E=3.46073e-73

glycine cleavage system protein H

X.species

NP_638224.1 lcl|gcvH-XCC2876

1

131

S=626 I=93 E=2.19189e-69

glycine cleavage system protein H

X.species

lcl|gcvH-XALc_2204

1

131

S=580 I=85 E=7.59409e-64

putative glycine cleavage system h protein

pubmed

1

129

S=379 I=56 E=5.18252e-38

Glycine cleavage system H protein ; Lipoyl

Pubmed 1802033,8375392

 

prodomImg

pubmed

1

130

S=349 I=55 E=2.15993e-34

Mitochondrial glycine decarboxylase complex H-protein ; Lipoyl

Pubmed 17355947

 

prodomImg

pubmed

9

127

S=341 I=60 E=2.25429e-33

Mitochondrial glycine decarboxylase complex H

Pubmed 16361241

 

prodomImg

pubmed

1

130

S=334 I=53 E=1.45654e-32

Glycine decarboxylase complex H-protein ; Lipoyl

Pubmed 14984933

 

prodomImg

pubmed

3

129

S=329 I=54 E=5.67566e-32

Glycine cleavage system H protein ; Lipoyl

Pubmed 12925792

 

prodomImg

pubmed

7

126

S=317 I=57 E=1.92205e-30

GcvH, glycine cleavage system H protein Glycine cleavage system H protein ; Lipoyl

Pubmed 10858227

 

prodomImg

pubmed

4

126

S=304 I=46 E=6.68147e-29

Glycine cleavage system H protein ; Lipoyl

Pubmed 17107561

 

prodomImg

pubmed

4

129

S=287 I=44 E=7.15218e-27

Glycine cleavage system H protein ; Lipoyl

Pubmed 19014707

 

prodomImg

pubmed

8

129

S=285 I=46 E=1.31672e-26

Glycine cleavage system H protein, mitochondrial ; Lipoyl Mitochondrion Transit peptide

Pubmed 7550380,8552027

 

prodomImg

pubmed

3

127

S=284 I=46 E=1.89901e-26

Glycine cleavage system H protein ; Lipoyl

Pubmed 18812508

 

prodomImg

sp

1

131

S=663 I=100 E=1.37395e-72

Glycine cleavage system H protein ; Lipoyl

 

prodomImg

sp

1

131

S=659 I=98 E=4.9498e-72

Glycine cleavage system H protein ; Lipoyl

 

prodomImg

sp

1

131

S=659 I=98 E=4.9498e-72

Glycine cleavage system H protein ; Lipoyl

 

prodomImg

sp

1

131

S=659 I=98 E=4.9498e-72

Glycine cleavage system H protein ; Lipoyl

 

prodomImg

sp

1

131

S=657 I=99 E=7.20124e-72

Glycine cleavage system H protein ; Lipoyl

 

prodomImg

Iprscan [G3DSA:2.40.50.100]

2

127

-

Iprscan IPR002930 [PTHR11715]

1

129

Glycine cleavage H-protein

Iprscan IPR002930 [PF01597]

8

129

Glycine cleavage H-protein

Iprscan IPR017453 [TIGR00527]

3

130

Glycine cleavage H-protein, subgroup

Iprscan IPR003016 [PS00189]

49

78

2-oxo acid dehydrogenase, lipoyl-binding site

PD370715

26

85

S=189 I=68 E=1.81979e-15

PDA1T4T8

4

89

S=140 I=39 E=1.89138e-09

PD767454

16

108

S=119 I=27 E=5.96859e-07

PDA1U3Y1

1

24

S=106 I=79 E=2.4063e-05

PD632443

4

82

S=105 I=30 E=2.94062e-05

Iprscan IPR011053 [SSF51230]

3

128

Single hybrid motif

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zuLxZlID)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

42 hits
swiss-prot

Swiss-Prot ncbi-blastp

417 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

1 hits
Interpro Scan

IprScan

6 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr15730.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr15730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr15730.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr15730.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr23750166_2527038_r1_XFF4834R-XFF4834R_chr21780 XFF4834R_chr21780
XFF4834R_chr21770
XFF4834R_chr21770
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21790
XFF4834R_chr21790
ID XFF4834R_chr23750166_2527038_r1_XFF4834R-XFF4834R_chr21780
AC XFF4834R_chr21780
LT XFF4834R_chr21780
OR XFF4834R_chr from 2526166 to 2527038 on strand -
DE putative Glycine cleavage T-protein
IP Glycine cleavage T-protein, N-terminal; Glycine cleavage T-protein, C-terminal barrel; Folate-binding, YgfZ
CL 1.1.3.5 Glycine cleavage GO:0019464
EC
GO InterPro
Biological Process: glycine catabolic process (GO:0006546)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: aminomethyltransferase activity (GO:0004047)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120402)
MW 30956.1 Da
SQ 290 aa
 
........10........20........30........40........50
| | | | |
MADNLNLIPQGFGSLHDMQYVRLAGTDAVAFAHAQFANDVQALAVGQWQW
NAWLTAKGRVIAIFALLREDDAHLLMLLPDGNAAEIATQLSRFVFRRKLK
IVTATLFAYGGFAAPEHAHAARAEIGTQRIELDLGSAALPRTLLLYSADA
LATPIELPSADAQWRATDLQLGLARLVEGQREQWTPQQLALDRLQAYSVK
KGCYPGQEIVARTHFLGKAKRALQLLETGAAVNAGDAVALDGSAIGTVVS
VAGNLALAVLPLELTLDAGTALQAGTHGARPRALTTGLER
X.species

NP_642394.1 lcl|XAC2074-XAC2074

1

290

S=1245 I=88 E=7.73103e-144

hypothetical protein

X.species

YP_363970.1 lcl|XCV2239

1

290

S=1193 I=85 E=1.60003e-137

putative aminomethyl transferase

X.species

NP_637495.1 lcl|XCC2133

1

290

S=990 I=68 E=6.84452e-113

hypothetical protein

X.species

lcl|XALc_1828

1

290

S=658 I=56 E=1.07865e-72

putative glycine cleavage system t (aminomethyltransferase) protein

sp

21

228

S=165 I=26 E=1.26425e-11

tRNA-modifying protein ygfZ ; Cytoplasm Folate-binding processing

 

prodomImg

sp

13

238

S=160 I=27 E=6.12618e-11

tRNA-modifying protein ygfZ ; Cytoplasm Folate-binding processing

 

prodomImg

sp

8

243

S=159 I=27 E=7.29322e-11

tRNA-modifying protein ygfZ ; Cytoplasm Folate-binding processing

 

prodomImg

sp

15

243

S=156 I=27 E=1.71395e-10

tRNA-modifying protein ygfZ ; Cytoplasm Folate-binding processing

 

prodomImg

sp

12

223

S=154 I=27 E=3.26737e-10

Uncharacterized protein HI0466

 

prodomImg

Iprscan IPR006222 [PF01571]

15

105

Glycine cleavage T-protein, N-terminal

Iprscan IPR013977 [PF08669]

202

250

Glycine cleavage T-protein, C-terminal barrel

Iprscan IPR017703 [TIGR03317]

162

228

Folate-binding, YgfZ

Iprscan [seg]

113

124

-

Iprscan [seg]

255

268

-

PDA1V3E2

219

290

S=190 I=60 E=1.80913e-15

PD604211

108

162

S=163 I=58 E=2.96628e-12

PD008318

161

221

S=133 I=43 E=1.18353e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one DhIc7SSi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

68 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr21780.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr21780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr21780.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr21780.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_3425781_3427223_f3_XFF4834R-XFF4834R_chr29820 XFF4834R_chr29820
XFF4834R_chr29810
XFF4834R_chr29810
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr29830
XFF4834R_chr29830
ID XFF4834R_chr_3425781_3427223_f3_XFF4834R-XFF4834R_chr29820
AC XFF4834R_chr29820
LT XFF4834R_chr29820
OR XFF4834R_chr from 3425781 to 3427223 on strand +
DE probable dihydrolipoamide dehydrogenase
IP Mercuric reductase
CL 1.1.3.5 Glycine cleavage GO:0019464
EC
GO InterPro
Biological Process: cell redox homeostasis (GO:0045454)
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: dihydrolipoyl dehydrogenase activity (GO:0004148)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by opruvost (20100817)
MW 50433.8 Da
SQ 480 aa
 
........10........20........30........40........50
| | | | |
MSEQEQFDVVVIGAGPAGYHAAIRAAQLGMKVACIDAALGKDGKPALGGT
CLRVGCIPSKALLDSSRQFWNMGHLFGDHGISFNDAKMDVPTMIGRKDKI
VKQFTGGIAMLFKANKITPYYGFGQLQPGNIVKVTQHEGGEIELKGTNVI
LAAGSESIELPFAKFDGDTIVDNVGGLDFTAVPKRLAVIGAGVIGLELGS
VWKRLGAEVTILEALPDFLALADAEVAKTALKEFKKQGLDIKLGAKVGKT
EITGSGDAKQVLLSYTDAAGEQTLTVDKLLVAVGRKAATKNLLAEGTGVK
VTDRGQIEVDGHCHTGVDGVWAIGDCVRGPMLAHKGFEEGIAVAELIAGL
PGHVNFDTIPWVIYTEPEIAWVGKTEQQLKAEGVAYKAGSFPFAAIGRAV
AMGEPAGFVKVIADAETDRVLGMHLVGVGVSELVHEGVLTMEFNGSADDL
ARICHAHPTLSEAIHDAAMAVSKRAIHKAN
XFF4834R

XFF4834R_chr35550 lcl|lpd-XFF4834R_chr35550

6

468

S=759 I=38 E=2.8573e-85

lipoamide dehydrogenase, E3 component is part of three enzyme complexes

XFF4834R

XFF4834R_chr18820 lcl|gor-XFF4834R_chr18820

1

464

S=269 I=25 E=6.22697e-26

glutathione oxidoreductase

XFF4834R

XFF4834R_chr09120 lcl|ahpF-XFF4834R_chr09120

91

330

S=99 I=29 E=2.71966e-05

alkyl hydroperoxide reductase, F52a subunit, FAD/NAD(P)-binding

X.species

YP_363307.1 lcl|lpd-XCV1576

1

480

S=2483 I=99 E=0

dihydrolipoamide dehydrogenase

X.species

NP_641866.1 lcl|ldp-XAC1533

4

480

S=2454 I=99 E=0

dihydrolipoamide dehydrogenase

X.species

NP_636857.1 lcl|ldp-XCC1485

4

480

S=2450 I=98 E=0

dihydrolipoamide dehydrogenase

X.species

lcl|lpd-XALc_1670

1

480

S=2244 I=89 E=0

probable dihydrolipoamide dehydrogenase protein

X.species

NP_635936.1 lcl|lpdA-XCC0544

6

468

S=772 I=39 E=3.02668e-86

dihydrolipoamide dehydrogenase

X.species

YP_365508.1 lcl|lpdA-XCV3777

6

468

S=765 I=39 E=1.87217e-85

dihydrolipoamide dehydrogenase

X.species

NP_643966.1 lcl|lpdA-XAC3659

6

468

S=761 I=39 E=6.68614e-85

dihydrolipoamide dehydrogenase

X.species

lcl|lpdA-XALc_2914

9

468

S=737 I=38 E=4.87274e-82

probable dihydrolipoamide dehydrogenase (e3 component of 2-oxoglutarate dehydrogenase complex) protein

X.species

NP_639231.1 lcl|XCC3891

6

462

S=469 I=28 E=1.60797e-49

mercuric reductase

X.species

NP_643059.1 lcl|XAC2750-XAC2750

1

464

S=272 I=25 E=1.0281e-25

reductase

X.species

YP_364634.1 lcl|XCV2903

1

464

S=265 I=24 E=7.57086e-25

putative glutathione reductase

X.species

NP_637927.1 lcl|XCC2579

1

464

S=246 I=24 E=1.51824e-22

reductase

X.species

YP_364034.1 lcl|XCV2303

3

474

S=224 I=25 E=7.47386e-20

dihydrolipoamide dehydrogenase

X.species

YP_363910.1 lcl|XCV2179

184

369

S=133 I=29 E=7.15171e-09

putative NAD(FAD)-dependent oxidoreductase

X.species

NP_636224.1 lcl|ahpF-XCC0833

91

330

S=105 I=29 E=2.12146e-05

alkyl hydroperoxide reductase subunit F

X.species

YP_362673.1 lcl|ahpF-XCV0942

91

330

S=99 I=29 E=9.33986e-05

Alkyl hydroperoxide reductase subunit F

pubmed

4

480

S=1392 I=59 E=9.25413e-160

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 2515251,8487301

 

prodomImg

pubmed

5

480

S=1377 I=59 E=5.42792e-158

Dihydrolipoamide dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 1902462,2914869

 

prodomImg

pubmed

4

480

S=1356 I=59 E=2.1865e-155

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 2832161,2404760

 

prodomImg

pubmed

4

477

S=1269 I=54 E=7.94898e-145

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 8867378

 

prodomImg

pubmed

6

477

S=1128 I=49 E=9.91702e-128

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein NAD Oxidoreductase Redox-active center

Pubmed 15585501

 

prodomImg

sp

4

480

S=1392 I=59 E=6.29731e-160

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

 

prodomImg

sp

4

480

S=1391 I=59 E=8.47025e-160

Dihydrolipoamide dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

 

prodomImg

sp

5

480

S=1377 I=59 E=3.69363e-158

Dihydrolipoamide dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

 

prodomImg

sp

4

480

S=1356 I=59 E=1.48788e-155

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

 

prodomImg

sp

4

477

S=1269 I=54 E=5.40917e-145

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

 

prodomImg

Iprscan [PR00411]

8

30

-

Iprscan [PR00411]

47

62

-

Iprscan [PR00411]

149

158

-

Iprscan [PR00411]

185

210

-

Iprscan [PR00411]

277

291

-

Iprscan [PR00411]

320

327

-

Iprscan [PR00411]

355

376

-

Iprscan [PR00411]

420

435

-

Iprscan [PR00411]

442

462

-

Iprscan IPR013027 [PR00368]

8

30

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

149

158

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

185

210

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

277

291

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR013027 [PR00368]

320

327

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR000815 [PR00945]

18

36

Mercuric reductase

Iprscan IPR000815 [PR00945]

185

202

Mercuric reductase

Iprscan IPR000815 [PR00945]

205

220

Mercuric reductase

Iprscan IPR000815 [PR00945]

391

411

Mercuric reductase

Iprscan [G3DSA:3.50.50.60]

6

359

-

Iprscan IPR004099 [G3DSA:3.30.390.30]

358

477

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan IPR006258 [PTHR22912:SF20]

10

476

Dihydrolipoamide dehydrogenase

Iprscan [PTHR22912]

10

476

-

Iprscan IPR013027 [PF07992]

8

330

FAD-dependent pyridine nucleotide-disulphide oxidoreductase

Iprscan IPR004099 [PF02852]

359

468

Pyridine nucleotide-disulphide oxidoreductase, dimerisation

Iprscan IPR001327 [PF00070]

185

264

Pyridine nucleotide-disulphide oxidoreductase, NAD-binding region

Iprscan IPR006258 [TIGR01350]

6

478

Dihydrolipoamide dehydrogenase

Iprscan IPR012999 [PS00076]

48

58

Pyridine nucleotide-disulphide oxidoreductase, class I, active site

PD757262

348

463

S=157 I=31 E=1.70871e-11

PDA2T2T7

354

472

S=148 I=30 E=2.41973e-10

PDA5D736

360

466

S=141 I=30 E=1.66182e-09

PDA201I5

331

358

S=137 I=93 E=5.16213e-09

PD470694

398

452

S=136 I=48 E=6.7054e-09

PDA12532

223

374

S=134 I=32 E=1.01016e-08

PDA0J409

397

468

S=125 I=36 E=1.46841e-07

PD451768

7

66

S=120 I=45 E=4.97689e-07

PDA7A7Y2

331

358

S=117 I=79 E=1.45445e-06

PDA1F7U0

87

117

S=116 I=65 E=1.60085e-06

Iprscan [SSF51905]

6

321

-

Iprscan IPR016156 [SSF55424]

356

477

FAD/NAD-linked reductase, dimerisation

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3lgdLxPe)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

274 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

29 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr29820.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr29820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr29820.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr29820.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
gcvP XFF4834R_chr33260
XFF4834R_chr33250
XFF4834R_chr33250
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3518
XFF4834R_chr_3518
ID gcvP
AC XFF4834R_chr33260
LT XFF4834R_chr33260
OR XFF4834R_chr from 3823772 to 3826636 on strand +
DE probable glycine decarboxylase
IP Glycine cleavage system P-protein; Pyridoxal phosphate-dependent transferase, major region, subdomain 1
CL 1.1.3.5 Glycine cleavage GO:0019464
EC
GO InterPro
Biological Process: glycine metabolic process (GO:0006544)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: glycine dehydrogenase (decarboxylating) activity (GO:0004375)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: pyridoxal phosphate binding (GO:0030170)

Curated
PM
AN glycine decarboxylase, PLP-dependent, subunit (protein P) of glycine cleavage complex
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110303)
MW 102448.6 Da
SQ 954 aa
 
........10........20........30........40........50
| | | | |
MSQTPSSLRDLEHHSAFVERHIGPNDAEIAQMLDVVGHACLDALTDAIVP
GNIKSPAPLALPEAITEEEALAKIRAIADKNTVFRNFIGQGYYGTHTPKV
ILRNILENPAWYTAYTPYQAEISQGRMEALINFQTLCADLTGMQIANASL
LDEATAAAEAMTLAKRSARSKSTTFFVHDAVHPQTLELLRTRAEPLDIVL
RVGTPEEALQAECFGVLLQYPDSFGHIGDHAALADAVHAQGGLVAVATDL
LALTLIAAPGEWGADIVVGNSQRFGVPFGFGGPHAAFMACRDAYKRSMPG
RLIGVSIDAAGNPAYRLTLQTREQHIRREKATSNICTAQVLLAVMASMYA
VYHGPDGLTRIARRTHRLAAILAAALRSAGVTVGERFFDTLHVKAIDADA
IHAGARAAGINLRAIDSEAVGISLDETTTRADVVALAQLFGATADVDALD
AATADALPQGLLRTTPFLTHPVFNTHHSEHELLRYMRSLADKDLAMDRTM
IPLGSCTMKLNATAEMIPVTWPEFGAIHPLAPAEQSAGYAQLIGELEAML
VECTGYDAVSLQPNSGAQGEYAGLLAIRAYHRSRGQAHRDICLIPESAHG
TNPASAQMCGMTVVVTKCDANGNVDVEDIRAKAEKYSDRLAALMITYPST
HGVFEEDVVAICEAVHAHGGQVYTDGANMNALVGVAKPGKWGSDVSHLNL
HKTFCIPHGGGGPGVGPCAVKSHLAPFLPRTLGGEGDVGMVSAASYGSAS
ILPISWMYVTMMGSAGLRKATQVALLNANYIAKRLAPHYKTLYTGRNGLV
AHECILDVRPLEKTSGIGAEDIAKRLIDFGFHAPTLSFPVAGTLMVEPTE
SESQHELDRFIDAMIQIREEIRAIEDGRLDREDNPLKHAPHTATQVSASE
WTHAYPRELAAFPLPSLKQQKYWPPVARVDNVYGDKNVMCACIPVDAYKE
DAEA
pubmed

1

949

S=2600 I=54 E=0

Glycine dehydrogenase [decarboxylating] EC=1.4.4.2 ; Oxidoreductase Pyridoxal phosphate

Pubmed 8181752,8375392

 

prodomImg

pubmed

7

954

S=2439 I=49 E=0

Glycine dehydrogenase [decarboxylating] A, mitochondrial EC=1.4.4.2 ; Mitochondrion Oxidoreductase Pyridoxal phosphate Transit peptide

Pubmed 7724679,8165245

 

prodomImg

pubmed

7

954

S=2436 I=49 E=0

Glycine dehydrogenase [decarboxylating] B, mitochondrial EC=1.4.4.2 ; Mitochondrion Oxidoreductase Pyridoxal phosphate Transit peptide

Pubmed 8529630

 

prodomImg

pubmed

3

946

S=2411 I=49 E=0

Glycine dehydrogenase [decarboxylating], mitochondrial EC=1.4.4.2 ; Mitochondrion Oxidoreductase Pyridoxal phosphate Transit peptide

Pubmed 14671022

 

prodomImg

pubmed

9

949

S=2409 I=48 E=0

Glycine dehydrogenase [decarboxylating], mitochondrial EC=1.4.4.2 ; Disease mutation Mitochondrion Oxidoreductase Phosphoprotein Pyridoxal phosph

Pubmed 1996985,1993704

 

prodomImg

pubmed

2

954

S=2404 I=49 E=0

Glycine dehydrogenase [decarboxylating], mitochondrial EC=1.4.4.2 ; Mitochondrion Oxidoreductase Pyridoxal phosphate Transit peptide

Pubmed 1347530

 

prodomImg

pubmed

17

948

S=2391 I=51 E=0

Glycine dehydrogenase [decarboxylating] EC=1.4.4.2 ; Oxidoreductase Pyridoxal phosphate

Pubmed 10858227

 

prodomImg

pubmed

16

950

S=2384 I=49 E=0

Glycine dehydrogenase [decarboxylating] EC=1.4.4.2 ; Oxidoreductase Pyridoxal phosphate

Pubmed 17107561

 

prodomImg

pubmed

11

949

S=2375 I=48 E=0

Glycine decarboxylase p protein

Pubmed 8709225,10488106

 

prodomImg

pubmed

5

940

S=2353 I=48 E=0

Victorin binding protein

Pubmed 7919984

 

prodomImg

sp

1

954

S=4474 I=89 E=0

Glycine dehydrogenase [decarboxylating] EC=1.4.4.2 ; Oxidoreductase Pyridoxal phosphate

 

prodomImg

sp

1

954

S=4366 I=86 E=0

Glycine dehydrogenase [decarboxylating] EC=1.4.4.2 ; Oxidoreductase Pyridoxal phosphate

 

prodomImg

sp

1

954

S=4296 I=84 E=0

Glycine dehydrogenase [decarboxylating] EC=1.4.4.2 ; Oxidoreductase Pyridoxal phosphate

 

prodomImg

sp

1

954

S=4259 I=84 E=0

Glycine dehydrogenase [decarboxylating] EC=1.4.4.2 ; Oxidoreductase Pyridoxal phosphate

 

prodomImg

sp

1

954

S=4259 I=84 E=0

Glycine dehydrogenase [decarboxylating] EC=1.4.4.2 ; Oxidoreductase Pyridoxal phosphate

 

prodomImg

Iprscan [coil]

626

647

-

Iprscan IPR015421 [G3DSA:3.40.640.10]

511

743

Pyridoxal phosphate-dependent transferase, major region, subdomain 1

Iprscan IPR020581 [PTHR11773]

14

953

Glycine cleavage system P-protein-like

Iprscan IPR020580 [PF02347]

19

440

Glycine cleavage system P-protein, N-terminal

Iprscan IPR020580 [PF02347]

446

729

Glycine cleavage system P-protein, N-terminal

Iprscan IPR003437 [TIGR00461]

20

942

Glycine cleavage system P-protein

Iprscan [seg]

146

164

-

Iprscan [seg]

243

258

-

Iprscan [seg]

358

377

-

Iprscan [seg]

395

410

-

Iprscan [seg]

442

457

-

Iprscan [seg]

707

717

-

PD471673

788

944

S=555 I=67 E=1.55007e-59

PD445371

458

605

S=533 I=72 E=6.29874e-57

PD003559

76

145

S=325 I=81 E=9.4564e-32

PD408705

304

441

S=266 I=43 E=1.39181e-24

PD690281

606

732

S=252 I=44 E=6.91726e-23

PD833445

1

84

S=179 I=45 E=5.61798e-14

PD003536

751

785

S=147 I=74 E=3.7493e-10

PDA1V3G2

1

26

S=139 I=100 E=3.23011e-09

PDA1E131

889

924

S=125 I=61 E=1.91118e-07

PDA1F8D5

165

203

S=124 I=62 E=2.66188e-07

Iprscan IPR015424 [SSF53383]

473

875

Pyridoxal phosphate-dependent transferase, major domain

Iprscan IPR015424 [SSF53383]

59

445

Pyridoxal phosphate-dependent transferase, major domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one C9jtLdPi)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

40 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

14 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr33260.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr33260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr33260.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBccVmn2/XFF4834R_chr33260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
lpdA XFF4834R_chr35550
XFF4834R_chr35540
XFF4834R_chr35540
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35560
XFF4834R_chr35560
ID lpdA
AC XFF4834R_chr35550
LT XFF4834R_chr35550
OR XFF4834R_chr from 4126457 to 4128265 on strand -
DE probable dihydrolipoamide dehydrogenase (e3 component of 2-oxoglutarate dehydrogenase complex)
IP Biotin/lipoyl attachment; 2-oxo acid dehydrogenase, lipoyl-binding site; Pyridine nucleotide-disulphide oxidoreductase, dimerisation; Pyridine nucleotide-disulphide oxidoreductase, class I, active site
CL 1.1.3.5 Glycine cleavage GO:0019464
EC
GO InterPro
Biological Process: cell redox homeostasis (GO:0045454)
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: dihydrolipoyl dehydrogenase activity (GO:0004148)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: acur
CC STATUS: curated by opruvost (20100503)
MW 62852.9 Da
SQ 602 aa
 
........10........20........30........40........50
| | | | |
MAVIEIKVPDIGDYSDVPVIEVLVAVGDSVAKDQGLVTLESDKATLEVPS
SAAGVVKELKVKVGDTLSEGALVLLLETEGEAAETKAAPAAAAPTAAPGS
KPPVTPSHRAPAEPAPSKPALASGKPADIECKMVVLGAGPGGYTAAFRAA
DLGLDTVLIERYASLGGVCLNVGCIPSKALLHAAAVIDEVAHAGDFGVDF
GQPRITLDKLREYKEKVVGKLTGGLASMAKQRKVRTVTGVASFVSPNELE
IVGDDGKTQLLRFEHCIIAAGSQAVKLPNFPWDDKRVMDSTDALELHDIP
KTLLVVGGGIIGLEMATVYSALGSKVTVVEFMDQLMPGADKDLVKPLADR
LKKQGVEVHLKTKATDVKADKSGITVSFEAAVEGEKPGLQATAYDRVLVA
VGRSPNGKKIGAEKAGVTITERGFIPVDRQMRTNVPHIFAIGDIVGNPML
AHKATHEGKLAAEVAAGEKKEWVARVIPSVAYTNPEIAWVGVTETEAKAK
GLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEQTHRVIGGAIVGVHAGD
LLAEIGLAIEMGAEAEDIGHTIHAHPTLSESVGMAAEVYDGTITDLYIPK
KK
XFF4834R

XFF4834R_chr29820 lcl|XFF4834R_chr_3425781_3427223_f3_XFF4834R-XFF4834R_chr29820

133

586

S=665 I=35 E=8.61262e-74

XFF4834R

XFF4834R_chr18820 lcl|gor-XFF4834R_chr18820

147

582

S=308 I=26 E=1.4517e-30

glutathione oxidoreductase

XFF4834R

XFF4834R_chr35570 lcl|aceF-XFF4834R_chr35570

3

68

S=288 I=88 E=4.0195e-28

pyruvate dehydrogenase, dihydrolipoyltransacetylase component E2

XFF4834R

XFF4834R_chr35570 lcl|aceF-XFF4834R_chr35570

1

68

S=266 I=83 E=1.81348e-25

pyruvate dehydrogenase, dihydrolipoyltransacetylase component E2

XFF4834R

XFF4834R_chr29810 lcl|sucB-XFF4834R_chr29810

5

68

S=112 I=42 E=8.50684e-07

dihydrolipoyltranssuccinase

XFF4834R

XFF4834R_chr04350 lcl|XFF4834R_chr04520330_0500847_r1_XFF4834R-XFF4834R_chr04350

5

67

S=100 I=38 E=2.48397e-05

XFF4834R

XFF4834R_chr29820 lcl|XFF4834R_chr_3425781_3427223_f3_XFF4834R-XFF4834R_chr29820

133

586

S=665 I=35 E=8.61262e-74

XFF4834R

XFF4834R_chr18820 lcl|gor-XFF4834R_chr18820

147

582

S=308 I=26 E=1.4517e-30

glutathione oxidoreductase

X.species

NP_643966.1 lcl|lpdA-XAC3659

1

602

S=2620 I=88 E=0

dihydrolipoamide dehydrogenase

X.species

YP_365508.1 lcl|lpdA-XCV3777

1

602

S=2599 I=87 E=0

dihydrolipoamide dehydrogenase

X.species

NP_635936.1 lcl|lpdA-XCC0544

1

602

S=2527 I=83 E=0

dihydrolipoamide dehydrogenase

X.species

lcl|lpdA-XALc_2914

1

602

S=2405 I=79 E=0

probable dihydrolipoamide dehydrogenase (e3 component of 2-oxoglutarate dehydrogenase complex) protein

X.species

lcl|lpd-XALc_1670

133

586

S=686 I=37 E=9.72822e-76

probable dihydrolipoamide dehydrogenase protein

X.species

YP_363307.1 lcl|lpd-XCV1576

133

586

S=671 I=35 E=6.17177e-74

dihydrolipoamide dehydrogenase

X.species

NP_636857.1 lcl|ldp-XCC1485

133

586

S=667 I=35 E=2.24291e-73

dihydrolipoamide dehydrogenase

X.species

NP_641866.1 lcl|ldp-XAC1533

133

586

S=659 I=35 E=2.0361e-72

dihydrolipoamide dehydrogenase

X.species

NP_639231.1 lcl|XCC3891

134

537

S=419 I=30 E=1.93607e-43

mercuric reductase

X.species

NP_637927.1 lcl|XCC2579

147

582

S=332 I=27 E=6.73831e-33

reductase

pubmed

126

602

S=1367 I=58 E=1.32699e-156

Putative dihydrolipoamide dehydrogenase ; Lipoyl

Pubmed 18456849

 

prodomImg

pubmed

1

68

S=214 I=65 E=6.30181e-17

Putative dihydrolipoamide dehydrogenase ; Lipoyl

Pubmed 18456849

 

prodomImg

pubmed

127

602

S=1353 I=59 E=5.8373e-155

Dihydrolipoamide dehydrogenase EC=1.8.1.4 ; Lipoyl Oxidoreductase

Pubmed 8021225

 

prodomImg

pubmed

1

53

S=173 I=66 E=5.18023e-12

Dihydrolipoamide dehydrogenase EC=1.8.1.4 ; Lipoyl Oxidoreductase

Pubmed 8021225

 

prodomImg

pubmed

128

602

S=1344 I=56 E=7.31641e-154

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; FAD Flavoprotein NAD Oxidoreductase Redox-active center

Pubmed 12819049

 

prodomImg

pubmed

128

602

S=1334 I=56 E=1.27724e-152

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Acetylation Cell inner membrane Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductas

Pubmed 6352260,8202364

 

prodomImg

pubmed

128

602

S=1325 I=56 E=1.32146e-151

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

Pubmed 9620967

 

prodomImg

pubmed

124

602

S=1216 I=53 E=2.603e-138

Outer membrane protein P64k or PM-6 ; Lipoyl

Pubmed 10234839

 

prodomImg

pubmed

1

50

S=145 I=54 E=1.384e-08

Outer membrane protein P64k or PM-6 ; Lipoyl

Pubmed 10234839

 

prodomImg

pubmed

143

602

S=1184 I=53 E=1.55103e-134

Pyruvate dehydrogenase, E3 component, lipoamide dehydrogenase EC=1.8.1.4 ; Lipoyl Oxidoreductase

Pubmed 11559360

 

prodomImg

sp

128

602

S=1349 I=57 E=1.08602e-154

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

 

prodomImg

sp

128

602

S=1334 I=56 E=8.79498e-153

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Acetylation Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active cent

 

prodomImg

sp

128

602

S=1334 I=56 E=8.79498e-153

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Acetylation Cell inner membrane Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductas

 

prodomImg

sp

128

602

S=1334 I=56 E=8.79498e-153

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Acetylation Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active center

 

prodomImg

sp

128

602

S=1334 I=56 E=8.79498e-153

Dihydrolipoyl dehydrogenase EC=1.8.1.4 ; Acetylation Cytoplasm Disulfide bond FAD Flavoprotein Glycolysis NAD Oxidoreductase Redox-active cent

 

prodomImg

PD327876

398

463

S=148 I=51 E=2.18223e-10

PDA12532

340

491

S=145 I=32 E=5.0397e-10

PDA7P2T2

173

234

S=139 I=42 E=2.52876e-09

PDA1F9G0

571

602

S=138 I=84 E=4.1566e-09

PD459598

164

208

S=133 I=57 E=1.66262e-08

PD451768

133

184

S=126 I=48 E=9.76008e-08

PDA205T8

209

234

S=125 I=100 E=1.3954e-07

PD895269

395

491

S=124 I=31 E=1.66123e-07

PD000268

1

53

S=117 I=48 E=1.2127e-06

PDA8E661

208

302

S=113 I=32 E=4.18251e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL