Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr24920XFF4834R_chr27230598_2879757_r1_XFF4834R-XFF4834R_chr24920XFF4834R_chr24920NAD-specific glutamate dehydrogenase

XFF4834R_chr27230598_2879757_r1_XFF4834R-XFF4834R_chr24920 XFF4834R_chr24920
XFF4834R_chr24910
XFF4834R_chr24910
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr24930
XFF4834R_chr24930
ID XFF4834R_chr27230598_2879757_r1_XFF4834R-XFF4834R_chr24920
AC XFF4834R_chr24920
LT XFF4834R_chr24920
OR XFF4834R_chr from 2874637 to 2879574 on strand -
DE NAD-specific glutamate dehydrogenase
IP Bacterial NAD-glutamate dehydrogenase; Bacterial NAD-glutamate dehydrogenase, N-terminal
CL 1.1.3.4 Glutamate degradation GO:0006538
EC
GO InterPro
Biological Process: oxidation-reduction process (GO:0055114)
Molecular Function: glutamate dehydrogenase (NAD+) activity (GO:0004352)
Molecular Function: nucleotide binding (GO:0000166)

Curated
PM
AN this gene is shorter than the ortholog in Xcv but the same than that of Xalb, for this reason the gene is not considered as a pseudogene
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120928)
MW 183719.6 Da
SQ 1645 aa
 
........10........20........30........40........50
| | | | |
MLATEPQAVTLEPVFAALRKRYPAARQAEVQAFAADFYRRMEEDEFPNHP
PEQWAALASDMLEFARARKAGTVNVRVFNPTLKSHGYESPHTLLQIVNDD
MPFLVDSVSMTLADLGIGVHVLGHPVLRIARDKAGKLTAVGEGRSESLMV
LEIDRQPPEEMPKLEAAVRKVLAEVRAIVQDWSAMRERMVMLADDLATRR
LPIDDLSRHEAQEFLRWAAADHFTFFGYREYRVEKQDGQDVLAPLEETGL
GLLRGRDTSPARPVTTLAAHGLNASSKLKDALILTKTNARSRVHRVGYMD
YIGILEFDAKGRIVGEQRFLGLFTSSAYNRRPWEIPLVRQRHEYVMSKSG
LTPSSHSGKALRHILETLPREELFQSNEEELYRTAMGILGLQERVRSRLF
LRRDKYGRFISALVYIPRERFNTDVRLRIEALLKDALHGEYIDSSVVLGE
SPLAQLHLIVRPKSGEALEFNTTELEARLAHLLRNWRDALREALVARHGE
ANGLRMAANFGRALPAGYIEDSSIESAVSDVEHLASLDGPDDLHLSLQEI
RRDDGVRLDAGEGLRLKLYRQLDDIPLSDAMPMMENMGLRVISERPYRLQ
VGETPVYIQDFEVESTSGKINAAHADASFGEAFERIWNGDAENDGFNRLI
LAAGLHWRQVALLRGYCKYLLQTAVPFSQAYVEATFTRYPLLARLLVELF
EARFDPSTGAETKAQIFAGQERLREELSALAGGDEATLKALEAVLEARGG
DRTAQQDATRATLLKLMDRVSSLDEDRILRSFIDVIDATLRTNYYQTDKN
GKHPHCISFKLDSARVPDLPKPRPYREIFVYGPRVEGVHLRFGAVARGGL
RWSDRREDFRTEVLGLVKAQMVKNTVIVPVGAKGGFYVKRSPVGGDRDAI
QAEGIACYKLFIQGLLDITDNIVGGKIVPPPQVVRHDQDDPYLVVAADKG
TATFSDIANGLALDHGFWLGDAFASGGSVGYDHKGMGITARGAWESVKRH
FRAMGRDCQSQDFSVVGIGDMSGDVFGNGMLLSRHIRLLAAFDHRHIFLD
PNPDAALSFAERDRLFKLPRSSWADYDAKLISAGGGIYPRTLKSIDISAP
VREALGLGASVKQLSPNELMNAILKAPVDLFWNGGIGTYVKAASESHADV
GDRANNGLRVNGGELRCKVVGEGGNLGLTQLGRIEAAQAGVLLNTDFIDN
SAGVDTSDHEVNIKILLNDMVQAKKLTYDARNKLLASMTDEVADLVLWDN
YRQNQAISLMERMSVKRLGSKQHFIRTLELQGLLDRQIEFLPSDAELSAR
KARGQGLSRPELSVLLSYSKLVAFQQLLESDIPEDPYLSKELQRYFPQPL
QKKYADAMERHRLKREIIATAVTNTTINRMGATFLMRMQEDTGRSIGEVA
KAYTISRETLDARALWTQIDALDGKVPESVQIDALEVIWRLQRSFVRWLL
LRPGQMPGITAAVERYHGPFNDIRVASGVLSDTQRPQYEGSVQEWQDKGL
PPQLAQQLSELRYLEPAFDIIETARTRKLKPVEVSKVHFRLGEALRLPWL
FEQIDALEVNGRWHAVARGVLRDELAAHQRVLVAQVLTLPGSSAEDKVAN
WLARDDSSLRFTLAMLADVAEQKTLDYPTVSVAVQRLGQLAAHGM
XFF4834R

NP_642811.1 XAC2496-XAC2496

1

1645

S=8396 I=96.6 E=0

hypothetical protein

xanac

XFF4834R

YP_364405.1 XCV2674

1

1645

S=8375 I=96.29 E=0

NAD-specific glutamate dehydrogenase

xanc5

XFF4834R

NP_637719.1 XCC2365

1

1645

S=8027 I=91.37 E=0

hypothetical protein

xancp

XFF4834R

XALc_1761 XALc_1761

10

1645

S=6883 I=79.71 E=0

putative bacterial nad-glutamate dehydrogenase oxidoreductase protein

xanal

pubmed

767

1640

S=2381 I=55.04 E=0

NAD-glutamate dehydrogenase

Pubmed 10924516

 

prodomImg

pubmed

37

706

S=1106 I=38.58 E=2.15095e-124

NAD-glutamate dehydrogenase

Pubmed 10924516

 

prodomImg

pubmed

751

1641

S=2367 I=53.22 E=0

NAD-specific glutamate dehydrogenase EC=1.4.1.2 ; Disulfide bond Oxidoreductase Reference proteome

Pubmed 11133942

 

prodomImg

pubmed

75

704

S=994 I=36.96 E=7.59882e-111

NAD-specific glutamate dehydrogenase EC=1.4.1.2 ; Disulfide bond Oxidoreductase Reference proteome

Pubmed 11133942

 

prodomImg

pubmed

770

1455

S=1685 I=51.52 E=0

NAD-glutamate dehydrogenase

Pubmed 17526698

 

prodomImg

sp_Pdown

sp|Q9HZE0|DHE2_PSEAE

751

1641

S=2367 I=53.22 E=0

NAD-specific glutamate dehydrogenase EC=1.4.1.2 ; Disulfide bond Oxidoreductase Reference proteome

sp_Pdown

sp|Q9HZE0|DHE2_PSEAE

75

704

S=994 I=36.96 E=4.57574e-111

NAD-specific glutamate dehydrogenase EC=1.4.1.2 ; Disulfide bond Oxidoreductase Reference proteome

sp_Pdown

sp|Q54VI3|GLUD2_DICDI

775

1219

S=204 I=25.93 E=2.35477e-15

Glutamate dehydrogenase 2 EC=1.4.1.2 ; Cytoplasm NAD Oxidoreductase Reference proteome

sp_Pdown

sp|P00365|DHE2_NEUCR

765

1231

S=188 I=24.58 E=1.84163e-13

NAD-specific glutamate dehydrogenase EC=1.4.1.2 ; Oxidoreductase Reference proteome

sp_Pdown

sp|P33327|DHE2_YEAST

778

1219

S=166 I=24.18 E=8.75508e-11

NAD-specific glutamate dehydrogenase EC=1.4.1.2 ; Oxidoreductase Phosphoprotein Reference proteome

Iprscan IPR016040 [G3DSA:3.40.50.720]

1122

1278

NAD(P)-binding domain

Iprscan IPR007780 [PIRSF036761]

3

1645

Bacterial NAD-glutamate dehydrogenase

Iprscan [PTHR11606:SF1]

68

1219

-

Iprscan [PTHR11606]

68

1219

-

Iprscan [PF05088]

75

1640

-

Iprscan IPR024727 [PF12466]

2

36

Bacterial NAD-glutamate dehydrogenase, N-terminal

Iprscan [seg]

24

35

-

Iprscan [seg]

249

256

-

Iprscan [seg]

1367

1378

-

PD025671

863

1216

S=1120 I=62.91 E=6.23737e-128

PD350232

66

481

S=1080 I=51.95 E=4.3068e-123

PD855287

1350

1644

S=486 I=38.13 E=3.78225e-51

PDA1F9D9

1217

1348

S=393 I=59.85 E=7.7952e-40

PD191967

482

654

S=364 I=49.45 E=2.11928e-36

PDA1F896

751

872

S=354 I=57.14 E=3.4504e-35

PDA1F896

653

735

S=254 I=58.14 E=5.19122e-23

PD292601

3

92

S=346 I=73.33 E=3.63267e-34

PDA3H753

677

730

S=263 I=98.15 E=3.82917e-24

PDA1W1Y3

1574

1616

S=196 I=88.37 E=4.98407e-16

Iprscan [SSF51735]

983

1321

-

Iprscan [SSF53223]

792

995

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one eBkVU7OU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

12 hits
swiss-prot

Swiss-Prot ncbi-blastp

3 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBym3wIg/XFF4834R_chr24920.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBym3wIg/XFF4834R_chr24920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBym3wIg/XFF4834R_chr24920.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBym3wIg/XFF4834R_chr24920.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.