Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr38750argIXFF4834R_chr38750probable arginase

argI XFF4834R_chr38750
XFF4834R_chr38740
XFF4834R_chr38740
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr38760
XFF4834R_chr38760
ID argI
AC XFF4834R_chr38750
LT XFF4834R_chr38750
OR XFF4834R_chr from 4467377 to 4468300 on strand -
DE probable arginase
IP Ureohydrolase; Arginase, subgroup
CL 1.1.3.3 Arginine catabolism GO:0006527
EC
GO InterPro
Biological Process: arginine metabolic process (GO:0006525)
Molecular Function: metal ion binding (GO:0046872)
Molecular Function: arginase activity (GO:0004053)
Molecular Function: hydrolase activity (GO:0016787)
in linear amidines (GO:0016813)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110303)
MW 33106.6 Da
SQ 307 aa
 
........10........20........30........40........50
| | | | |
MATQYVPVSLIGVPTDIGAGHRGARMGPEALRIAGLQEALVGRGVEVRDL
GNLDGPRNPWQAPQAGYRHLDEVVAWNQALMDASYAELRAGRMPIMLGGD
HCLGIGAITAVAKYCREQGRPLRVLWLDAHSDFNTSEVTPSGNVHGMPVA
CLCGLGPEALTHLGGSAPALLPEQVRQIGIRSVDPEEKRLIKQHRIDVYD
MRYIDEAGMKRTMEAALQGMSADTHLHVSFDVDFLDPSIAPGVGTTVPGG
PNYREAQLVMEMIADTGRMGSLDIVELNPVLDNRNATAELAVDLVESLFG
KSTLMRD
Show or not Domain decomposition
 
pubmed

6

287

S=915 I=64 E=2.84474e-102

Arginase-like protein ; Hydrolase Manganese Metal-binding

Pubmed 17074795

 

prodomImg

pubmed

8

306

S=611 I=46 E=1.9292e-65

Arginase ; Hydrolase Manganese Metal-binding Plasmid

Pubmed 8606160

 

prodomImg

pubmed

9

306

S=601 I=45 E=3.00695e-64

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding

Pubmed 9375792

 

prodomImg

pubmed

8

304

S=577 I=41 E=2.65477e-61

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding

Pubmed 7540694,9205843

 

prodomImg

pubmed

7

304

S=575 I=42 E=4.47938e-61

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding

Pubmed 8647285,10196128

 

prodomImg

pubmed

10

306

S=573 I=43 E=7.75832e-61

Tiorf190 protein ; Hydrolase Manganese Metal-binding Plasmid

Pubmed 10721727,9524202

 

prodomImg

pubmed

10

306

S=573 I=43 E=7.75832e-61

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding Plasmid

Pubmed 2806247,3040404

 

prodomImg

pubmed

10

306

S=559 I=43 E=4.59041e-59

Arginase EC=3.5.3.1 ; Hydrolase Manganese Metal-binding

Pubmed 9256491

 

prodomImg

pubmed

8

304

S=553 I=37 E=2.20507e-58

Arginase ; Hydrolase Manganese Metal-binding

Pubmed 17233729

 

prodomImg

pubmed

8

304

S=545 I=40 E=1.8029e-57

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding

Pubmed 9339546

 

prodomImg

sp_Pdown

sp|P0A2Y0|ARGI_BRUSU

9

306

S=601 I=45 E=2.07115e-64

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding

sp_Pdown

sp|P0A2X9|ARGI_BRUME

9

306

S=601 I=45 E=2.07115e-64

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding

sp_Pdown

sp|P0A2Y1|ARGI_BRUAB

9

306

S=601 I=45 E=2.07115e-64

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding

sp_Pdown

sp|P39138|ARGI_BACSU

8

304

S=577 I=41 E=1.82857e-61

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding

sp_Pdown

sp|P53608|ARGI_BACCD

7

304

S=575 I=42 E=3.08533e-61

Arginase EC=3.5.3.1 ; Arginine metabolism Hydrolase Manganese Metal-binding

Iprscan IPR005924 [PR00116]

97

112

Arginase

Iprscan IPR005924 [PR00116]

124

151

Arginase

Iprscan IPR005924 [PR00116]

178

196

Arginase

Iprscan IPR005924 [PR00116]

226

255

Arginase

Iprscan IPR005924 [PR00116]

261

275

Arginase

Iprscan IPR006035 [G3DSA:3.40.800.10]

1

300

Ureohydrolase

Iprscan IPR014033 [PTHR11358:SF2]

36

302

Arginase, subgroup

Iprscan IPR006035 [PTHR11358]

36

302

Ureohydrolase

Iprscan IPR006035 [PF00491]

8

299

Ureohydrolase

Iprscan IPR014033 [TIGR01229]

9

304

Arginase, subgroup

Iprscan [seg]

241

251

-

PD001703

8

302

S=328 I=34 E=3.01151e-32

PD445364

83

300

S=167 I=26 E=8.00856e-13

PDA5M6A5

168

306

S=108 I=28 E=1.20995e-05

PDA463M8

166

236

S=107 I=33 E=1.54451e-05

Iprscan [SSF52768]

6

306

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uL8DwIEE)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

40 hits
swiss-prot

Swiss-Prot ncbi-blastp

42 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4bM8rV/XFF4834R_chr38750.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4bM8rV/XFF4834R_chr38750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4bM8rV/XFF4834R_chr38750.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4bM8rV/XFF4834R_chr38750.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.