Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr08360tauDXFF4834R_chr08360Probable taurine dioxygenase, 2-oxoglutarate-dependent

tauD XFF4834R_chr08360
XFF4834R_chr08350
XFF4834R_chr08350
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr08370
XFF4834R_chr08370
ID tauD
AC XFF4834R_chr08360
LT XFF4834R_chr08360
OR XFF4834R_chr from 973291 to 974208 on strand -
DE Probable taurine dioxygenase, 2-oxoglutarate-dependent
IP Taurine catabolism dioxygenase TauD/TfdA
CL 1.1.3.17 Taurine
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN in GenProtEc 2 physiological roles are proposed 1.8.2 Sulfur metabolism GO:0006790 and 1.1..3.17 Metabolism --> Carbon compound utilization --> Amino acids --> Taurine
CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: acur
CC STATUS: curated by darrasse (20120329)
MW 34499.7 Da
SQ 305 aa
 
........10........20........30........40........50
| | | | |
MASITSAARVHTPRDASSPVQTSSVRIVPFDAPLGAEVIGLDLAQPLDAA
TFARIHRAHLDHHVLVFRDQRITPAQQVEFSRRFGPLQIHVLRNFQLRGQ
PEVLVVSNIKQNGEPIGLGDAGHYWHSDLSYKQTPSLGSLLHAQELPSEG
GDTLFANQHLAWQTLPESLKRTVQDLRAEHSYLAKYEELRARNPWRPALT
PEQIAEVTPVQHPVVRTHPETGRKALFVSEHFTTRIVGLPEDESRALLQT
LFEHSTHAALVYRHRWQPHDMVFWDNRSVMHLAAGTPDHLRRRLNRTTIE
GDAPF
Show or not Domain decomposition
 
X.species

YP_362614.1 lcl|tauD-XCV0883

1

305

S=1562 I=97 E=0

taurine dioxygenase

X.species

NP_641182.1 lcl|tauD-XAC0830

20

305

S=1494 I=99 E=6.20111e-174

taurine dioxygenase

pubmed

22

305

S=492 I=40 E=5.81598e-51

Alpha-ketoglutarate-dependent taurine dioxygenase EC=1.14.11.17 ; Hydroxylation Iron Metal-binding Oxidoreductase Vitamin

Pubmed 8808933

 

prodomImg

pubmed

24

305

S=485 I=41 E=3.56628e-50

Alpha-ketoglutarate-dependent dioxygenase

Pubmed 12835925

 

prodomImg

pubmed

16

304

S=412 I=35 E=2.82165e-41

R-2,4-dichlorophenoxypropionate dioxygenase

Pubmed 15345421

 

prodomImg

pubmed

16

304

S=412 I=35 E=2.82165e-41

(R)-2-(2,4-dichlorophenoxy)propionate,2-oxoglutarate dioxygenase R-2,4-dichlorophenoxypropionate dioxygenase

Pubmed 15345421,11423952

 

prodomImg

pubmed

16

304

S=412 I=35 E=2.82165e-41

R-2, 4-dichlorophenoxypropionate/alpha-ketoglutarate dioxygenase

Pubmed 15345421

 

prodomImg

pubmed

24

303

S=382 I=36 E=1.08723e-37

Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase EC=1.14.11.- ; Aromatic hydrocarbons catabolism Hydroxylation Iron Metal-bindi

Pubmed 3036764,15186344

 

prodomImg

pubmed

25

304

S=377 I=35 E=4.2737e-37

Putative dioxygenase

Pubmed 15205436

 

prodomImg

pubmed

18

304

S=374 I=36 E=1.08633e-36

PlaO1

Pubmed 16632249

 

prodomImg

pubmed

27

302

S=364 I=35 E=1.76865e-35

(S)-2-(2,4-dichlorophenoxy)propionate,2-oxoglutarate dioxygenase

Pubmed 11423952,15466552

 

prodomImg

pubmed

64

303

S=354 I=38 E=3.16939e-34

2,4-D/alpha-ketoglutarate dioxygenase

Pubmed 12949179

 

prodomImg

sp

22

305

S=492 I=40 E=4.00632e-51

Alpha-ketoglutarate-dependent taurine dioxygenase EC=1.14.11.17 ; Hydroxylation Iron Metal-binding Oxidoreductase Vitamin

 

prodomImg

sp

24

303

S=382 I=36 E=7.48939e-38

Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase EC=1.14.11.- ; Aromatic hydrocarbons catabolism Hydroxylation Iron Metal-bindi

 

prodomImg

sp

36

301

S=347 I=35 E=1.23769e-33

Alpha-ketoglutarate-dependent 2,4-dichlorophenoxyacetate dioxygenase EC=1.14.11.- ; Aromatic hydrocarbons catabolism Iron Metal-binding Oxidoreductase Vita

 

prodomImg

sp

21

304

S=308 I=32 E=6.75353e-29

Uncharacterized dioxygenase Mb3440 EC=1.-.-.- ; Oxidoreductase

 

prodomImg

sp

21

304

S=308 I=32 E=6.75353e-29

Uncharacterized dioxygenase Rv3406/MT3514 EC=1.-.-.- ; Oxidoreductase

 

prodomImg

Iprscan IPR003819 [PF02668]

33

298

Taurine catabolism dioxygenase TauD/TfdA

PD009920

34

305

S=444 I=45 E=2.24531e-46

PDA2G934

1

31

S=135 I=90 E=7.25096e-09

PDA5A2M2

212

281

S=124 I=39 E=1.43015e-07

PD317041

235

296

S=103 I=35 E=4.63269e-05

Iprscan [SSF51197]

24

305

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one SmSy6WvY)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

97 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZmAm3u/XFF4834R_chr08360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZmAm3u/XFF4834R_chr08360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZmAm3u/XFF4834R_chr08360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBZmAm3u/XFF4834R_chr08360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.