Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr02800XFF4834R_chr_0326338_0327798_r1_XFF4834R-XFF4834R_chr02800XFF4834R_chr02800putative amidase signature (AS) protein

XFF4834R_chr_0326338_0327798_r1_XFF4834R-XFF4834R_chr02800 XFF4834R_chr02800
XFF4834R_chr02790
XFF4834R_chr02790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr02810
XFF4834R_chr02810
ID XFF4834R_chr_0326338_0327798_r1_XFF4834R-XFF4834R_chr02800
AC XFF4834R_chr02800
LT XFF4834R_chr02800
OR XFF4834R_chr from 326338 to 327798 on strand -
DE putative amidase signature (AS) protein
IP Amidase
CL 1.1.3.16 Glutamine
EC
GO InterPro
with glutamine as amido-N-donor (GO:0016884)

Curated
PM
AN
CC COG: [J] Translation, ribosomal structure and biogenesis;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100804)
MW 50176.4 Da
SQ 486 aa
 
........10........20........30........40........50
| | | | |
MQLPAQWQAGVDRNTEVLRGHAQLLATFHAPPATAHDGSGSRGQIASIVS
TTRSQPTLAARLATQTLTRINQANDRLCAITRLLPARAAADAARVQAALA
GGSDGGALAGVPFVVKDLFDVAGQVTTAGAAVRAHCPPASRDAAVVQRLG
EAGAVLVGTANMDEFAYGFATVNAHYGTTANPHDDQHLAGGSSGGSAAAV
AAGLVPFALGSDTNGSIRVPAALCGIYGLRPTHGAVPLDGVFPFVDALDV
VGPFATSVADLRHVYDVLRGQPLPACHAGKLRVARLGGWFERNLDPDLEA
GLQALLAACNSLLSIDLPEAERARAAAFVLTAAEGGHRHRGALTAHGAQF
DPATRDRLLAGLQLPASAVADAHRFAQWFADAMHALWDQVDVLIAPATPC
VAPRIDQDTIQIDGLPVSARANLGIFTQPLGLAACPVLAAPLPRPGRLPL
GVQLIAAPGREDRLFALAAQLERDGLLAFSPPPEPR
XFF4834R

XFF4834R_chr10080 lcl|XFF4834R_chr10580023_1142687_r2_XFF4834R-XFF4834R_chr10080

111

260

S=182 I=33 E=2.25739e-15

XFF4834R

YP_362046.1 lcl|gatA-XCV0315

1

486

S=1782 I=75 E=0

amidase

XFF4834R

NP_640662.1 lcl|gatA-XAC0306

17

486

S=1735 I=76 E=0

amidase

XFF4834R

NP_635687.1 lcl|gatA-XCC0292

1

486

S=1496 I=64 E=5.34079e-174

amidase

XFF4834R

NP_644621.1 lcl|uahA-XAC4327

111

260

S=212 I=36 E=1.99503e-18

amidase

XFF4834R

NP_641349.1 lcl|gatAX-XAC1002

111

260

S=182 I=33 E=8.99348e-15

amidase

XFF4834R

YP_362761.1 lcl|XCV1030

111

260

S=181 I=34 E=1.2858e-14

amidase

XFF4834R

NP_636310.1 lcl|gatAX-XCC0924

111

260

S=163 I=31 E=1.78787e-12

amidase

pubmed

111

476

S=581 I=38 E=1.63686e-61

Putative oxalurate amidohydrolase

Pubmed 19060149

 

prodomImg

pubmed

111

272

S=280 I=42 E=4.56165e-25

Chloroplast Toc64-1 ; Repeat TPR

Pubmed 15010601

 

prodomImg

pubmed

111

270

S=280 I=41 E=5.06478e-25

Glutamyl-tRNA(Gln) amidotransferase subunit A EC=6.3.5.- ; ATP-binding Ligase Nucleotide-binding Protein biosynthesis

Pubmed 19370165

 

prodomImg

pubmed

111

264

S=271 I=40 E=7.2351e-24

Chloroplast Toc64-2 ; Repeat TPR

Pubmed 15010601

 

prodomImg

pubmed

142

273

S=269 I=43 E=1.19967e-23

Glutamyl-tRNA(Gln) amidotransferase subunit A EC=6.3.5.- ; Ligase

Pubmed 12446909

 

prodomImg

sp_Pdown

sp|Q12VH1|GATA_METBU

111

270

S=302 I=40 E=8.70567e-28

Glutamyl-tRNA(Gln) amidotransferase subunit A EC=6.3.5.- ; ATP-binding Ligase Nucleotide-binding Protein biosynthesis

sp_Pdown

sp|B8G974|GATA_CHLAD

142

408

S=299 I=32 E=1.95861e-27

Glutamyl-tRNA(Gln) amidotransferase subunit A EC=6.3.5.- ; ATP-binding Ligase Nucleotide-binding Protein biosynthesis

sp_Pdown

sp|Q5X4H5|GATA_LEGPA

111

407

S=295 I=27 E=5.92698e-27

Glutamyl-tRNA(Gln) amidotransferase subunit A EC=6.3.5.- ; ATP-binding Ligase Nucleotide-binding Protein biosynthesis

sp_Pdown

sp|Q1J0C2|GATA_DEIGD

111

270

S=293 I=42 E=8.77458e-27

Glutamyl-tRNA(Gln) amidotransferase subunit A EC=6.3.5.- ; ATP-binding Ligase Nucleotide-binding Protein biosynthesis

sp_Pdown

sp|Q5ZUQ7|GATA_LEGPH

111

407

S=293 I=27 E=9.16555e-27

Glutamyl-tRNA(Gln) amidotransferase subunit A EC=6.3.5.- ; ATP-binding Ligase Nucleotide-binding Protein biosynthesis

Iprscan IPR000120 [G3DSA:3.90.1300.10]

44

473

Amidase

Iprscan [PTHR11895:SF7]

53

473

-

Iprscan IPR000120 [PTHR11895]

53

473

Amidase

Iprscan IPR000120 [PF01425]

63

464

Amidase

Iprscan IPR014087 [TIGR02715]

44

479

Amidohydrolase, AtzE type

Iprscan [seg]

57

69

-

Iprscan [seg]

82

110

-

Iprscan [seg]

121

134

-

Iprscan [seg]

189

203

-

Iprscan [seg]

319

327

-

Iprscan [seg]

429

452

-

PD865818

354

422

S=303 I=87 E=3.96132e-29

PD038838

111

270

S=273 I=42 E=1.51312e-25

PD694125

17

118

S=239 I=54 E=2.06413e-21

PD860566

281

352

S=170 I=47 E=4.98953e-13

PD928990

205

249

S=143 I=56 E=9.82468e-10

PDA35873

252

279

S=129 I=86 E=4.55387e-08

PDA35872

252

276

S=107 I=76 E=2.18387e-05

Iprscan IPR000120 [SSF75304]

37

485

Amidase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 0oS6QnCl)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

129 hits
swiss-prot

Swiss-Prot ncbi-blastp

617 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGRmuKv/XFF4834R_chr02800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGRmuKv/XFF4834R_chr02800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGRmuKv/XFF4834R_chr02800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBGRmuKv/XFF4834R_chr02800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.