Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr00800XFF4834R_chr_0094929_0095819_f3_XFF4834R-XFF4834R_chr00800XFF4834R_chr00800putative phenylalanine-4-hydroxylase
  2. XFF4834R_chr04450pseudo_hmgAXFF4834R_chr04450probable homogentisate 1,2-dioxygenase 2 pseudogene
  3. XFF4834R_chr14560XFF4834R_chr15530916_1669677_r1_XFF4834R-XFF4834R_chr14560XFF4834R_chr14560putative HpcH/HpaI aldolase family protein
  4. XFF4834R_chr35020XFF4834R_chr38200057_4065719_r2_XFF4834R-XFF4834R_chr35020XFF4834R_chr35020putative maleylacetoacetate isomerase

XFF4834R_chr_0094929_0095819_f3_XFF4834R-XFF4834R_chr00800 XFF4834R_chr00800
XFF4834R_chr00790
XFF4834R_chr00790
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0094
XFF4834R_chr_0094
ID XFF4834R_chr_0094929_0095819_f3_XFF4834R-XFF4834R_chr00800
AC XFF4834R_chr00800
LT XFF4834R_chr00800
OR XFF4834R_chr from 94929 to 95819 on strand +
DE putative phenylalanine-4-hydroxylase
IP Aromatic amino acid hydroxylase; Phenylalanine-4-hydroxylase, monomeric form; Aromatic amino acid hydroxylase, iron/copper binding site
CL 1.1.3.15 Phenylalanine, tyrosine degradation GO:0006559 GO:0006572
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: aromatic amino acid family metabolic process (GO:0009072)
Biological Process: L-phenylalanine catabolic process (GO:0006559)
Molecular Function: monooxygenase activity (GO:0004497)
Molecular Function: iron ion binding (GO:0005506)
Molecular Function: phenylalanine 4-monooxygenase activity (GO:0004505)
and incorporation of one atom of oxygen (GO:0016714)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 33405.5 Da
SQ 296 aa
 
........10........20........30........40........50
| | | | |
MTTAPQRVENQLTDKGYVPVYTTAVVEQPWDGYSADDHATWGTLYRRQRE
LLVGRACEEFLQAQDAMGMGQTHIPRFDALNRVLQAATGWTLVGVQGLLP
ELDFFDHLANKRFPVTWWIRRPDQIDYIAEPDLFHDLFGHVPLLMNPLFA
DFMQAYGRGGVKAHGIGPDALQNLTRLYWYTVEFGLIDTPQGLRIYGAGI
VSSKGESLYSLESPAPNRIGFDLQRIMRTRYRIDSFQKTYFVIDSFAQLM
QATAPDFTPIYAELAQQPQVPAGDVLPGDRVIQRGSGEGWSRDGDV
Show or not Domain decomposition
 
XFF4834R

NP_640530.1 lcl|phhA-XAC0174

1

296

S=1558 I=99 E=0

phenylalanine 4-monooxygenase

XFF4834R

YP_361888.1 lcl|phhA-XCV0157

1

296

S=1534 I=97 E=7.1803e-179

phenylalanine 4-monooxygenase

XFF4834R

NP_635551.1 lcl|phhA-XCC0156

1

296

S=1452 I=92 E=7.05877e-169

phenylalanine 4-monooxygenase

XFF4834R

lcl|phhA-XALc_0054

1

296

S=1311 I=83 E=7.39723e-152

probable phenylalanine-4-hydroxylase protein

pubmed

28

296

S=922 I=63 E=3.6299e-103

Phenylalanine-4-hydroxylase EC=1.14.16.1 ; Iron Metal-binding Monooxygenase Oxidoreductase catabolism

Pubmed 1655752

 

prodomImg

pubmed

17

279

S=775 I=55 E=2.54503e-85

Phenylalanine-4-hydroxylase

Pubmed 15305924

 

prodomImg

pubmed

22

263

S=540 I=45 E=8.57475e-57

Phenylalanine-4-hydroxylase EC=1.14.16.1 ; Iron Metal-binding Monooxygenase Oxidoreductase catabolism

Pubmed 8108417

 

prodomImg

pubmed

33

256

S=527 I=46 E=2.98077e-55

Phenylalanine 4-hydroxylase

Pubmed 15262943

 

prodomImg

pubmed

29

253

S=351 I=35 E=5.5836e-34

Protein henna EC=1.14.16.1 EC=1.14.16.4 ; Allosteric enzyme Iron Metal-binding Monooxygenase Oxidoreductase Phenylalanine catabolism Phosphoprotein

Pubmed 1371286,2121612

 

prodomImg

pubmed

29

246

S=351 I=37 E=6.70549e-34

Tryptophan hydroxylase

Pubmed 17624455

 

prodomImg

pubmed

29

248

S=349 I=36 E=1.05519e-33

Tryptophan 5-hydroxylase 1 EC=1.14.16.4 ; Iron Metal-binding Monooxygenase Oxidoreductase Phosphoprotein Serotonin biosynthesis

Pubmed 8915576

 

prodomImg

pubmed

29

247

S=345 I=36 E=3.27774e-33

Phenylalanine-4-hydroxylase EC=1.14.16.1 ; Acetylation Allosteric enzyme Iron Metal-binding Monooxygenase Oxidoreductase catabolism Phosphoprotein

Pubmed 2869038,7387651

 

prodomImg

pubmed

29

247

S=344 I=37 E=4.85252e-33

Tyrosine 3-monooxygenase EC=1.14.16.2 ; Catecholamine biosynthesis Iron Metal-binding Neurotransmitter Oxidoreductase Phosphoprotein Polymorphism

Pubmed 16210796

 

prodomImg

pubmed

29

247

S=342 I=36 E=6.99843e-33

Tyrosine hydroxylase

Pubmed 7577670,7504087

 

prodomImg

sp_Pdown

sp|Q8XU39|PH4H_RALSO

25

296

S=940 I=64 E=1.8792e-105

Phenylalanine-4-hydroxylase EC=1.14.16.1 ; Iron Metal-binding Monooxygenase Oxidoreductase catabolism

sp_Pdown

sp|P30967|PH4H_CHRVO

28

296

S=922 I=63 E=2.50151e-103

Phenylalanine-4-hydroxylase EC=1.14.16.1 ; Iron Metal-binding Monooxygenase Oxidoreductase catabolism

sp_Pdown

sp|Q9A7V7|PH4H_CAUCR

25

286

S=797 I=55 E=4.24156e-88

Phenylalanine-4-hydroxylase EC=1.14.16.1 ; Iron Metal-binding Monooxygenase Oxidoreductase catabolism

sp_Pdown

sp|P43334|PH4H_PSEAE

22

263

S=540 I=45 E=5.90922e-57

Phenylalanine-4-hydroxylase EC=1.14.16.1 ; Iron Metal-binding Monooxygenase Oxidoreductase catabolism

sp_Pdown

sp|Q98D72|PH4H_RHILO

25

275

S=518 I=43 E=2.42225e-54

Phenylalanine-4-hydroxylase EC=1.14.16.1 ; Iron Metal-binding Monooxygenase Oxidoreductase catabolism

Iprscan IPR001273 [G3DSA:1.10.800.10]

16

296

Aromatic amino acid hydroxylase

Iprscan IPR019774 [PF00351]

33

246

Aromatic amino acid hydroxylase, C-terminal

Iprscan IPR005960 [TIGR01267]

23

272

Phenylalanine-4-hydroxylase, monomeric form

Iprscan IPR018301 [PS00367]

131

142

Aromatic amino acid hydroxylase, iron/copper binding site

PD002559

28

288

S=721 I=53 E=7.65447e-80

PDA1S3E2

266

296

S=143 I=90 E=8.59523e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one x8fLdFvK)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

64 hits
swiss-prot

Swiss-Prot ncbi-blastp

35 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

4 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr00800.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr00800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr00800.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr00800.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr04450

Cluster
DrawMap
XML file

FASTA file
Framed Extract
Sequence

ID pseudo_hmgA
AC XFF4834R_chr04450
LO XFF4834R_chr04450
DE probable homogentisate 1,2-dioxygenase 2 pseudogene
CL 1.1.3.15 Phenylalanine, tyrosine degradation GO:0006559 GO:0006572
GO InterPro
2-dioxygenase activity (GO:0004411)
Biological Process: tyrosine metabolic process (GO:0006570)
Biological Process: oxidation-reduction process (GO:0055114)
Biological Process: L-phenylalanine catabolic process (GO:0006559)

Curated
PM
AN ORF XFF4834R_chr_0491 and XFF4834R_chr04460 have been deleted. They corresponded to the N- and C-terminal fragments of a homogentisate 1,2-dioxygenase 2 gene. There is a frameshift at position 513925 from +1 to +3. Orthologous genes in Xanthomonas are for example XCV0484, XAC0454, XCC0438 and Xalc2737.
CC MODEL:
CC STATUS: curated by darrasse (20120319)
SQ 1313 nt
 
........10........20........30........40........50
| | | | |
ATGCATGACAAGACTTCCTACATGACCGGCTTCGGCAATGAGTTCGCAAC
CGAGGCGGTGGCCGGCAGTCTACCGGTCGGGCAGAACTCACCGCAGCGCG
TGGCGCATGGCCTGTACGCCGAGCAGTTGTCCGGCACTGCGTTCACCGCG
CCACGCGGCGAGAATCGGCGCAGCTGGCTGTATCGCATTCGCCCTGCCGC
GGTGCATGGCAGCTTCTCGCTGCTCGAGCAGTCGCACTTCCACAACGGTT
TCGGCGCGGGCCCGGTGCCGCCGGATCAGTTGCGCTGGAGCCCATTGCCA
CTGCCGTCGGTGCCCACCGATTTTGTCGACGGCCTCTACACCATGGCCGG
CAATGGCGGGCCCGAAGCGATGTCCGGCGTTGGCGTGCATGTGTATGCGG
CCAACGCCTCCATGCAGGATCGCTTCTTCTACGACGCCGACGGCGAGCTG
CTGCTGGTGCCGCAGCAGGGCCGGCTGCGCGTGCATACCGAGCTGGGCGT
GCTGGCGCTGGAACCGCAGCAGATTGGTGTGATTCCACGTGGCATGCGCT
TTCGCGTCGAGTTGCTGGACGACACCGCGCGCGGCTATGTGTGCGAAAAC
TTTGGCGGGCTGCTGCGCCTGCCCGATCTGGGGCCGATCGGCGCCAATGG
CCTGGCCAATCCGCGCGATTTCGAAACGCCGCACGCCGCCTTCGAACGAC
GCGAAGGCACGTTCGAACTGGTGGCCAAATTCCAGGGCCATCTATGGCGT
GCCGACATCGGTCACTCGCCGCTGGATGTCGTCGCCTGGCACGGCAATTA
CGCGCCCTACCGTTATGACCTGCGTCGCTTCAACACCATCGGCTCGATCA
GTTTCGATCACCCGATCCCAGCATCTTCACCGTGCTGACCTCGCCCAGCG
ACACGCACGGGACTGCGAACATGGATTTTGCGATTTTCCCGCCGCGTTGG
CTGGTGGCACAGCACACCTTCCGCCCGCCGTGGTTCCATCGCAACGTCGC
CAGCGAATTCATGGGCCTGGTGCATGGCGTCTACGATGCCAAGGCCGAAG
GCTTCGCGCCCGGTGGCGCCTCGTTGCATAACTGCATGAGCGGGCACGGC
CCGGATGCGGCCACTTTCGACAAGGCTTCACAGGCAGATCTCACGCGTCC
GGACGTGATCGCCGACACCATGGCCTTCATGTTCGAAACGCGTGCGGTGT
TGCGCCCTACGCAGCAGGCATTGAATGCCACCCATCGGCAAGCCGATTAC
CAACAGTGCTGGTCCGGACTGCGCGCTGCATTTCAACCGTCCACGACGGA
AGACGCGAAGTAG
Show or not Domain decomposition
 
Iprscan IPR005708 [PTHR11056]

1

290

Homogentisate 1,2-dioxygenase

Iprscan IPR005708 [PTHR11056]

15

157

Homogentisate 1,2-dioxygenase

Iprscan IPR005708 [PF04209]

7

291

Homogentisate 1,2-dioxygenase

Iprscan IPR005708 [PF04209]

12

154

Homogentisate 1,2-dioxygenase

Iprscan [seg]

59

89

-

Iprscan [seg]

166

180

-

Iprscan [seg]

25

40

-

Iprscan [seg]

122

160

-

Iprscan [seg]

208

226

-

Iprscan [seg]

242

256

-

Iprscan [seg]

3

21

-

Iprscan [seg]

38

56

-

Iprscan [seg]

104

142

-

Iprscan [seg]

35

51

-

Iprscan [SignalP-NN(euk)]

1

20

-

Iprscan [SignalP-NN(euk)]

1

3

-

Iprscan [SignalP-NN(euk)]

1

32

-

Iprscan IPR011051 [SSF51182]

3

290

Cupin, RmlC-type

Iprscan IPR011051 [SSF51182]

15

161

Cupin, RmlC-type

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one PioGJ6kV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastx

0 hits
swiss-prot

Swiss-Prot ncbi-blastx

0 hits
trembl

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastx

0 hits
Interpro Scan

IprScan

19 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr04450.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr04450.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr04450.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr04450.xml_fasta", "blastx"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr15530916_1669677_r1_XFF4834R-XFF4834R_chr14560 XFF4834R_chr14560
XFF4834R_chr14550
XFF4834R_chr14550
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr14570
XFF4834R_chr14570
ID XFF4834R_chr15530916_1669677_r1_XFF4834R-XFF4834R_chr14560
AC XFF4834R_chr14560
LT XFF4834R_chr14560
OR XFF4834R_chr from 1668916 to 1669677 on strand -
DE putative HpcH/HpaI aldolase family protein
IP HpcH/HpaI aldolase
CL 1.1.3.15 Phenylalanine, tyrosine degradation GO:0006559 GO:0006572
EC
GO InterPro
Biological Process: cellular aromatic compound metabolic process (GO:0006725)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: carbon-carbon lyase activity (GO:0016830)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100713)
MW 26955.1 Da
SQ 253 aa
 
........10........20........30........40........50
| | | | |
MAVAVGILNALPSVQLCELLGRLGYGFVVLDLEHVLRAPDELEHSIRACE
LSGCEAWVRVPEVDEKLIGRVLDAGARGIVIPRIESAAQIGDAIAAARFP
PLGRRGITGGRVTGFGNVDLPTYIAQANAGIRIVPMIESAAGVAALPEIL
AIPGVALVMEGALDLALDLGLGPQPTHPQVWELLLQLHAQCIAANVPFCP
NPRTDAQRAHWLQQPQLRWMLAGEDRALIQRALRGHLASLAVPQSPPARR
STP
XFF4834R

NP_643483.1 lcl|mphE-XAC3175

1

253

S=1009 I=80 E=2.37286e-115

4-hydroxy-2-oxovalerate aldolase

XFF4834R

YP_365036.1 lcl|XCV3305

1

253

S=1006 I=80 E=6.03155e-115

HpcH/HpaI aldolase family protein

XFF4834R

NP_638396.1 lcl|mphE-XCC3049

1

253

S=919 I=73 E=2.15486e-104

4-hydroxy-2-oxovalerate aldolase

XFF4834R

lcl|XALc_0724

1

240

S=688 I=56 E=1.86317e-76

hypothetical hpch/hpai aldolase protein

pubmed

4

239

S=302 I=33 E=4.54819e-28

AcsB protein ; Lyase Magnesium Metal-binding Plasmid

Pubmed 15995217

 

prodomImg

pubmed

6

239

S=249 I=30 E=1.40575e-21

SbnG ; Lyase Magnesium Metal-binding

Pubmed 14688077

 

prodomImg

pubmed

3

155

S=147 I=29 E=2.72344e-09

4-hydroxy-2-oxovalerate aldolase EC=4.1.3.39 ; Aromatic hydrocarbons catabolism Lyase Magnesium Metal-binding Plasmid

Pubmed 10049392

 

prodomImg

pubmed

5

159

S=130 I=28 E=3.38107e-07

Macrophomate synthase

Pubmed 10731719,12634789

 

prodomImg

pubmed

5

186

S=126 I=23 E=8.82206e-07

4-hydroxy-2-oxovalerate aldolase ; Lyase Magnesium Metal-binding Plasmid

Pubmed 15574904,15607751

 

prodomImg

sp_Pdown

sp|B5REK4|GARL_SALG2

3

197

S=163 I=28 E=2.01225e-11

5-keto-4-deoxy-D-glucarate aldolase EC=4.1.2.20 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|Q5PCB8|GARL_SALPA

3

197

S=163 I=28 E=2.04764e-11

5-keto-4-deoxy-D-glucarate aldolase EC=4.1.2.20 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|A9MPQ4|GARL_SALAR

3

197

S=163 I=28 E=2.23418e-11

5-keto-4-deoxy-D-glucarate aldolase EC=4.1.2.20 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|Q7CPQ8|GARL_SALTY

3

197

S=162 I=28 E=2.6598e-11

5-keto-4-deoxy-D-glucarate aldolase EC=4.1.2.20 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|Q8XGF9|GARL_SALTI

3

197

S=162 I=28 E=2.6598e-11

5-keto-4-deoxy-D-glucarate aldolase EC=4.1.2.20 ; Lyase Magnesium Metal-binding

Iprscan IPR015813 [G3DSA:3.20.20.60]

3

240

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Iprscan IPR005000 [PF03328]

11

199

HpcH/HpaI aldolase

Iprscan [seg]

87

97

-

Iprscan [seg]

103

116

-

Iprscan [seg]

161

172

-

Iprscan [SignalP-NN(euk)]

1

16

-

PD692408

185

253

S=327 I=90 E=3.59852e-32

PD009456

5

155

S=134 I=28 E=9.13085e-09

Iprscan IPR015813 [SSF51621]

6

238

Pyruvate/Phosphoenolpyruvate kinase, catalytic core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one uDiiNaw0)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

10 hits
swiss-prot

Swiss-Prot ncbi-blastp

99 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr14560.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr14560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr14560.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr14560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr38200057_4065719_r2_XFF4834R-XFF4834R_chr35020 XFF4834R_chr35020
XFF4834R_chr35010
XFF4834R_chr35010
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr35030
XFF4834R_chr35030
ID XFF4834R_chr38200057_4065719_r2_XFF4834R-XFF4834R_chr35020
AC XFF4834R_chr35020
LT XFF4834R_chr35020
OR XFF4834R_chr from 4065057 to 4065719 on strand -
DE putative maleylacetoacetate isomerase
IP Maleylacetoacetate isomerase; Glutathione S-transferase, C-terminal-like; Thioredoxin fold; Glutathione S-transferase/chloride channel, C-terminal
CL 1.1.3.15 Phenylalanine, tyrosine degradation GO:0006559 GO:0006572
EC
GO InterPro
Biological Process: aromatic amino acid family metabolic process (GO:0009072)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN XCC and XAC homologues were named uptB on the basis of a paper on Xcc B100, however this name is not used anymore in Xcc B100
CC COG: [O] Posttranslational modification, protein turnover, chaperones;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20110315)
MW 24556.9 Da
SQ 220 aa
 
........10........20........30........40........50
| | | | |
MSAALELFSYWRSSAAYRVRIGLGLKALDYIAHPVHLVRDGGEQHAPAYA
QLNPQELVPTLRHGAVVIAQSLAILEYLEEAFADTTALLPRAPEERARVR
ALAQLIACDVHPLNNLRVLQALEREFALEGAQRQQWTRLWMARGFTALET
QLARDAQTGRFCHGDVPGLADCVLIPQLYNAHRFEVDLVPYPTLRRIEQA
CLQLPAFDAARPEMQADAVA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr37110 lcl|XFF4834R_chr40290220_4294876_r3_XFF4834R-XFF4834R_chr37110

42

83

S=92 I=45 E=6.84656e-05

predicted glutathione S-transferase

XFF4834R

NP_643915.1 lcl|uptB-XAC3608

1

220

S=992 I=87 E=2.12801e-113

maleylacetoacetate isomerase

XFF4834R

YP_365462.1 lcl|XCV3731

1

220

S=981 I=87 E=5.1741e-112

maleylacetoacetate isomerase

XFF4834R

NP_635984.1 lcl|uptB-XCC0592

1

218

S=800 I=72 E=4.22999e-90

maleylacetoacetate isomerase

XFF4834R

lcl|uptB-XALc_2718

1

218

S=666 I=61 E=7.4857e-74

probable maleylacetoacetate isomerase protein

XFF4834R

NP_644125.1 lcl|gst-XAC3819

42

83

S=97 I=48 E=7.25383e-05

glutathione S-transferase

pubmed

1

218

S=818 I=73 E=1.09292e-90

Putative maleylacetoacetate isomerase EC=5.2.1.2

Pubmed 11589581

 

prodomImg

pubmed

5

218

S=440 I=42 E=6.68356e-45

Maleylpyruvate isomerase ; Plasmid

Pubmed 9573207,11133965

 

prodomImg

pubmed

5

220

S=413 I=41 E=1.31604e-41

Putative glutathione-S-transferase

Pubmed 11682182,12635929

 

prodomImg

pubmed

5

219

S=401 I=42 E=3.11723e-40

Maleylpyruvate isomerase

Pubmed 15782938

 

prodomImg

pubmed

7

218

S=399 I=41 E=5.39907e-40

Glutathione transferase, zeta class (AGAP002898-PA) Glutathione S-transferase

Pubmed 12914673

 

prodomImg

pubmed

7

220

S=390 I=40 E=7.00731e-39

Maleylacetoacetate isomerase EC=5.2.1.2 EC=2.5.1.18 ; Cytoplasm Multifunctional enzyme Phenylalanine catabolism Transferase Tyrosine

Pubmed 10373324

 

prodomImg

pubmed

5

220

S=388 I=43 E=1.24583e-38

Maleylacetoacetate isomerase

Pubmed 15262943

 

prodomImg

pubmed

7

218

S=381 I=41 E=1.00977e-37

Glutathione transferase zeta 1

Pubmed 19088266

 

prodomImg

pubmed

7

218

S=377 I=40 E=2.56672e-37

Glutathione S-transferase zeta

Pubmed 18676034

 

prodomImg

pubmed

7

218

S=375 I=41 E=4.56338e-37

Maleylacetoacetate isomerase EC=5.2.1.2 EC=2.5.1.18 ; Cytoplasm Multifunctional enzyme Phenylalanine catabolism Polymorphism Transferase Tyrosine

Pubmed 9417084,9396740

 

prodomImg

sp_Pdown

sp|Q9KSB2|MAAI_VIBCH

4

218

S=454 I=44 E=8.97387e-47

Probable maleylacetoacetate isomerase EC=5.2.1.2 ; Phenylalanine catabolism Tyrosine

sp_Pdown

sp|P57109|MAAI_PSEAE

5

220

S=402 I=44 E=1.97413e-40

Maleylacetoacetate isomerase EC=5.2.1.2 ; Phenylalanine catabolism Tyrosine

sp_Pdown

sp|Q9VHD2|MAAI2_DROME

7

218

S=397 I=39 E=6.69093e-40

Probable maleylacetoacetate isomerase 2 EC=5.2.1.2 ; Alternative splicing Cytoplasm Phenylalanine catabolism Tyrosine

sp_Pdown

sp|Q9WVL0|MAAI_MOUSE

7

220

S=390 I=40 E=4.84198e-39

Maleylacetoacetate isomerase EC=5.2.1.2 EC=2.5.1.18 ; Cytoplasm Multifunctional enzyme Phenylalanine catabolism Transferase Tyrosine

sp_Pdown

sp|O43708|MAAI_HUMAN

7

218

S=375 I=41 E=3.15325e-37

Maleylacetoacetate isomerase EC=5.2.1.2 EC=2.5.1.18 ; Cytoplasm Multifunctional enzyme Phenylalanine catabolism Polymorphism Transferase Tyrosine

Iprscan IPR012335 [G3DSA:3.40.30.10]

5

83

Thioredoxin fold

Iprscan IPR010987 [G3DSA:1.20.1050.10]

89

217

Glutathione S-transferase, C-terminal-like

Iprscan IPR004045 [PF02798]

3

80

Glutathione S-transferase, N-terminal

Iprscan IPR005955 [TIGR01262]

6

219

Maleylacetoacetate isomerase

Iprscan IPR004045 [PS50404]

3

86

Glutathione S-transferase, N-terminal

Iprscan IPR017933 [PS50405]

92

218

Glutathione S-transferase/chloride channel, C-terminal

Iprscan [seg]

89

103

-

PDA931O3

4

218

S=220 I=35 E=3.65186e-19

PD995502

104

153

S=150 I=52 E=1.16682e-10

PDA739S8

165

217

S=139 I=51 E=1.96712e-09

PD632657

157

192

S=135 I=61 E=7.46736e-09

PDA6S9P1

6

41

S=130 I=72 E=2.90979e-08

PDA1F8T8

5

30

S=111 I=73 E=5.07543e-06

PDA1R328

193

218

S=109 I=85 E=1.10274e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one aAYctQeA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

30 hits
swiss-prot

Swiss-Prot ncbi-blastp

16 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr35020.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr35020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr35020.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBJtQXf_/XFF4834R_chr35020.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.