Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr02960XFF4834R_chr03100174_0345052_f2_XFF4834R-XFF4834R_chr02960XFF4834R_chr02960probable dehydrogenase protein

XFF4834R_chr03100174_0345052_f2_XFF4834R-XFF4834R_chr02960 XFF4834R_chr02960
XFF4834R_chr02950
XFF4834R_chr02950
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_0330
XFF4834R_chr_0330
ID XFF4834R_chr03100174_0345052_f2_XFF4834R-XFF4834R_chr02960
AC XFF4834R_chr02960
LT XFF4834R_chr02960
OR XFF4834R_chr from 344174 to 345052 on strand +
DE probable dehydrogenase protein
IP Fatty oxidation complex, alpha subunit FadB; 3-hydroxyacid dehydrogenase/reductase
CL 1.1.3.14 Valine degradation GO:0006574
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: pentose-phosphate shunt (GO:0006098)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: valine metabolic process (GO:0006573)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: 3-hydroxyisobutyrate dehydrogenase activity (GO:0008442)
Molecular Function: binding (GO:0005488)
Molecular Function: phosphogluconate dehydrogenase (decarboxylating) activity (GO:0004616)
Molecular Function: coenzyme binding (GO:0050662)

Curated
PM
AN 30 pourcent identity with coli gene name no valid yihU
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120320)
MW 30429.7 Da
SQ 292 aa
 
........10........20........30........40........50
| | | | |
MPIGFLGLGTMGLPMAHNLLRGGFALSVWNRSPERAHSLRDAGATVVEQP
RDAAHGPLLFSMLADDNAVRQTLLERGVLDALPAGIVHVNMATISVALAH
ELTALHAERGVAYVAAPVLGRVEVAEAGKLNILAAGDEAAVARLQPMFDA
LGQKTWHIGRAPEQANAVKLAANFCLASAIGAMAEASALARGHGVDATQF
LGMLTSTLFAAPAYQGYGRLIMQRQYLPAGFTATLGRKDVDLAIQAGADK
QVPMPLGELLRAGLDEAIAHGDGSADWAVLAEVSARRAGQVA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr31900 lcl|garR-XFF4834R_chr31900

3

286

S=153 I=26 E=4.42472e-12

tartronate semialdehyde reductase

XFF4834R

NP_640678.1 lcl|XAC0322-XAC0322

1

292

S=1317 I=89 E=1.30364e-152

dehydrogenase

XFF4834R

YP_362062.1 lcl|XCV0331

1

292

S=1281 I=86 E=3.73143e-148

putative dehydrogenase

XFF4834R

NP_635703.1 lcl|XCC0308

1

290

S=1160 I=81 E=1.55443e-133

dehydrogenase

XFF4834R

lcl|XALc_0167

1

290

S=846 I=62 E=1.7313e-95

hypothetical dehydrogenase protein

XFF4834R

NP_636638.1 lcl|mmsB-XCC1264

3

286

S=186 I=27 E=1.55034e-15

3-hydroxyisobutirate dehydrogenase

XFF4834R

NP_642594.1 lcl|XAC2277-XAC2277

111

291

S=167 I=30 E=3.3336e-13

3-hydroxyisobutirate dehydrogenase

XFF4834R

YP_363098.1 lcl|XCV1367

3

286

S=166 I=27 E=4.84991e-13

3-hydroxyisobutyrate dehydrogenase

XFF4834R

NP_641651.1 lcl|mmsB-XAC1316

3

286

S=156 I=26 E=6.51796e-12

3-hydroxyisobutirate dehydrogenase

Iprscan IPR016040 [G3DSA:3.40.50.720]

1

161

NAD(P)-binding domain

Iprscan IPR013328 [G3DSA:1.10.1040.10]

163

289

Dehydrogenase, multihelical

Iprscan IPR015815 [PTHR22981]

11

289

3-hydroxyacid dehydrogenase/reductase

Iprscan IPR006115 [PF03446]

2

159

6-phosphogluconate dehydrogenase, NAD-binding

Iprscan IPR002204 [PS00895]

5

18

3-hydroxyisobutyrate dehydrogenase-related, conserved site

Iprscan [seg]

97

108

-

Iprscan [seg]

176

190

-

Iprscan IPR016040 [SSF51735]

1

161

NAD(P)-binding domain

Iprscan IPR008927 [SSF48179]

161

289

6-phosphogluconate dehydrogenase, C-terminal-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one dm5KiOEc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

28 hits
swiss-prot

Swiss-Prot ncbi-blastp

35 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3Gqa4i/XFF4834R_chr02960.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3Gqa4i/XFF4834R_chr02960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3Gqa4i/XFF4834R_chr02960.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3Gqa4i/XFF4834R_chr02960.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.