Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr19850XFF4834R_chr21310930_2278583_r2_XFF4834R-XFF4834R_chr19850XFF4834R_chr19850putative methylthioribulose-1-phosphate dehydratase

XFF4834R_chr21310930_2278583_r2_XFF4834R-XFF4834R_chr19850 XFF4834R_chr19850
XFF4834R_chr19840
XFF4834R_chr19840
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr19860
XFF4834R_chr19860
ID XFF4834R_chr21310930_2278583_r2_XFF4834R-XFF4834R_chr19850
AC XFF4834R_chr19850
LT XFF4834R_chr19850
OR XFF4834R_chr from 2277930 to 2278583 on strand -
DE putative methylthioribulose-1-phosphate dehydratase
IP Class II aldolase/adducin, N-terminal
CL 1.1.3.13 Methionine degradation GO:0009087
EC
GO InterPro
Molecular Function: metal ion binding (GO:0046872)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 24264.4 Da
SQ 217 aa
 
........10........20........30........40........50
| | | | |
MNATTAPLPYSAARLHELAHLLIANIRELAHAGWTPATSSNFSHRLDEQH
AAITVSGRDKGRLVEEDIMVVDFDGLAVGRPLRPSAETLLHTQLYRRFPE
IGCVLHTHSPVQTIASRLYAGSGVIRLEGYELLKAFDGNTTHETAMEVPV
FANTQDMQVLATQVDALLDKQSMWGYLIEGHGLYAWGRNMAEARRHLEAF
EFLLHCELELLKLRGTR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr41170 lcl|fucA-XFF4834R_chr41170

16

120

S=154 I=37 E=2.43439e-12

L-fuculose-1-phosphate aldolase

XFF4834R

NP_642166.1 lcl|XAC1840-XAC1840

1

217

S=1030 I=91 E=6.11661e-118

hypothetical protein

XFF4834R

YP_363617.1 lcl|XCV1886

1

217

S=1016 I=89 E=2.85996e-116

hypothetical protein

XFF4834R

NP_637185.1 lcl|XCC1820

1

195

S=985 I=95 E=1.46938e-112

hypothetical protein

XFF4834R

lcl|XALc_1322

8

195

S=843 I=84 E=2.50911e-95

hypothetical class II aldolase and adducin family protein

XFF4834R

NP_644542.1 lcl|fucA-XAC4243

16

120

S=154 I=37 E=8.96476e-12

L-fuculose-phosphate aldolase

XFF4834R

YP_366080.1 lcl|XCV4349

22

120

S=148 I=37 E=3.8449e-11

putative L-fuculose-phosphate aldolase

pubmed

11

195

S=427 I=51 E=2.89716e-43

Methylthioribulose-1-phosphate dehydratase EC=4.2.1.109 ; Amino-acid biosynthesis Lyase Metal-binding Methionine Zinc

Pubmed 17965706

 

prodomImg

pubmed

33

195

S=302 I=41 E=3.68418e-28

Methylthioribulose-1-phosphate dehydratase EC=4.2.1.109 ; Amino-acid biosynthesis Lyase Metal-binding Methionine Zinc

Pubmed 16563686

 

prodomImg

pubmed

27

195

S=259 I=37 E=6.13665e-23

Methylthioribulose-1-phosphate dehydratase EC=4.2.1.109 ; Amino-acid biosynthesis Lyase Metal-binding Methionine Zinc

Pubmed 12022921

 

prodomImg

pubmed

53

193

S=174 I=34 E=1.2769e-12

L-ribulose-5-phosphate 4-epimerase

Pubmed 8031084,10368143

 

prodomImg

pubmed

19

194

S=143 I=26 E=6.44702e-09

Methylthioribulose-1-phosphate dehydratase EC=4.2.1.109 ; Amino-acid biosynthesis Cytoplasm Lyase Metal-binding Methionine Zinc

Pubmed 19465926

 

prodomImg

sp_Pdown

sp|Q8PLG0|MTNB_XANAC

1

217

S=1030 I=91 E=1.63495e-116

Methylthioribulose-1-phosphate dehydratase EC=4.2.1.109 ; Amino-acid biosynthesis Lyase Metal-binding Methionine Zinc

sp_Pdown

sp|Q3BUE6|MTNB_XANC5

1

217

S=1016 I=89 E=7.64456e-115

Methylthioribulose-1-phosphate dehydratase EC=4.2.1.109 ; Amino-acid biosynthesis Lyase Metal-binding Methionine Zinc

sp_Pdown

sp|B2SM82|MTNB_XANOP

1

217

S=1010 I=89 E=4.25887e-114

Methylthioribulose-1-phosphate dehydratase EC=4.2.1.109 ; Amino-acid biosynthesis Lyase Metal-binding Methionine Zinc

sp_Pdown

sp|Q5H0X8|MTNB_XANOR

1

217

S=1006 I=88 E=1.36989e-113

Methylthioribulose-1-phosphate dehydratase EC=4.2.1.109 ; Amino-acid biosynthesis Lyase Metal-binding Methionine Zinc

sp_Pdown

sp|Q2P3W4|MTNB_XANOM

1

217

S=999 I=88 E=7.97186e-113

Methylthioribulose-1-phosphate dehydratase EC=4.2.1.109 ; Amino-acid biosynthesis Lyase Metal-binding Methionine Zinc

Iprscan IPR001303 [G3DSA:3.40.225.10]

14

214

Class II aldolase/adducin, N-terminal

Iprscan [MF_01677]

14

215

-

Iprscan [PTHR10640:SF6]

13

215

-

Iprscan [PTHR10640]

13

215

-

Iprscan IPR001303 [PF00596]

22

208

Class II aldolase/adducin, N-terminal

Iprscan IPR017714 [TIGR03328]

22

213

Methylthioribulose-1-phosphate dehydratase

Iprscan [seg]

196

213

-

Iprscan [SignalP-NN(euk)]

1

32

-

PDA1K727

1

62

S=275 I=86 E=7.41633e-26

PD126575

127

195

S=149 I=41 E=1.23577e-10

PD001906

63

118

S=130 I=46 E=2.45668e-08

PDA240E1

16

63

S=104 I=48 E=3.75663e-05

Iprscan IPR001303 [SSF53639]

14

215

Class II aldolase/adducin, N-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rxORCjpQ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

29 hits
swiss-prot

Swiss-Prot ncbi-blastp

184 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBIQo5Zt/XFF4834R_chr19850.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBIQo5Zt/XFF4834R_chr19850.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBIQo5Zt/XFF4834R_chr19850.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBIQo5Zt/XFF4834R_chr19850.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.