Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr31500XFF4834R_chr34070239_3618339_f1_XFF4834R-XFF4834R_chr31500XFF4834R_chr31500probable leucine dehydrogenase

XFF4834R_chr34070239_3618339_f1_XFF4834R-XFF4834R_chr31500 XFF4834R_chr31500
XFF4834R_chr_3330
XFF4834R_chr_3330
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31510
XFF4834R_chr31510
ID XFF4834R_chr34070239_3618339_f1_XFF4834R-XFF4834R_chr31500
AC XFF4834R_chr31500
LT XFF4834R_chr31500
OR XFF4834R_chr from 3617239 to 3618339 on strand +
DE probable leucine dehydrogenase
IP Glutamate/phenylalanine/leucine/valine dehydrogenase; Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal; Glutamate/phenylalanine/leucine/valine dehydrogenase, dimerisation region
CL 1.1.3.12 Leucine degradation GO:0006552
EC
GO InterPro
Biological Process: oxidation reduction (GO:0055114)
Biological Process: cellular amino acid metabolic process (GO:0006520)
Molecular Function: oxidoreductase activity (GO:0016491)
NAD or NADP as acceptor (GO:0016639)

Curated
PM
AN ldh is the name of the gene in Bacillus stearothermophilus and functional studies confirm its role however this gene is not homologous yo the ldh gene of E. coli. this is the reason why no gene name is given for this accession
CC COG: [E] Amino acid transport and metabolism;
CC MODEL:
CC STATUS: curated by darrasse (20120405)
MW 39711.9 Da
SQ 366 aa
 
........10........20........30........40........50
| | | | |
MLFETLDTTGHEQVIFCHNRDAGLKAIIALHSTRLGPALGGVRMRPYASS
EAALNDALRLSRTMTYKNALAGLNVGGGKAVIIGDPRTDKTEALFRAFGR
FVDTLGGRYITSEDVGTDVNDMEQIYLESEYVTGVHQVHRGSGDPAPFTA
YGALQALMASLNRKLGHEEVGKASIAIQGLGHIGMELVKLLKERGAKLYV
ADLNQALVDRAVAEYGAEAVRPDEIHQVSADVFAPCALEGAINEDTLPQL
KAKIICGTANNQLASAAIGEELHRRGILYAPDYVVNAGGVMNVSLEIDGY
NRERAMRLIRSIYHNLEKVFDLSTQLDVSPQQAADQIAEARIEAISKLKL
PLGRTAPRFLHKLRGE
XFF4834R

YP_363134.1 lcl|ldh-XCV1403

1

366

S=1926 I=100 E=0

leucine dehydrogenase

XFF4834R

NP_641685.1 lcl|leu-XAC1350

1

366

S=1926 I=100 E=0

leucine dehydrogenase

XFF4834R

NP_636673.1 lcl|leu-XCC1299

1

366

S=1860 I=96 E=0

leucine dehydrogenase

XFF4834R

lcl|XALc_2523

1

366

S=1641 I=83 E=0

probable glu/leu/phe/val dehydrogenase protein

pubmed

2

364

S=1032 I=54 E=2.22151e-116

Leucine dehydrogenase EC=1.4.1.9 ; Branched-chain amino acid catabolism NAD Oxidoreductase

Pubmed 3069133,1400267

 

prodomImg

pubmed

2

364

S=1026 I=54 E=1.2594e-115

Leucine dehydrogenase EC=1.4.1.9 ; Oxidoreductase

Pubmed 15168170

 

prodomImg

pubmed

2

364

S=1019 I=53 E=8.49976e-115

Leucine dehydrogenase EC=1.4.1.9 ; Oxidoreductase

Pubmed 15168170

 

prodomImg

pubmed

2

343

S=985 I=53 E=1.24326e-110

Leucine dehydrogenase EC=1.4.1.9 ; Branched-chain amino acid catabolism NAD Oxidoreductase

Pubmed 8597545

 

prodomImg

pubmed

2

345

S=978 I=53 E=8.61323e-110

Leucine dehydrogenase EC=1.4.1.9 ; Branched-chain amino acid catabolism NAD Oxidoreductase

Pubmed 9188201

 

prodomImg

pubmed

2

349

S=977 I=52 E=1.26407e-109

Leucine dehydrogenase EC=1.4.1.9 ; Branched-chain amino acid catabolism NAD Oxidoreductase

Pubmed 8020469

 

prodomImg

pubmed

2

349

S=923 I=51 E=3.61213e-103

Oxidoreductase

Pubmed 8591046

 

prodomImg

pubmed

2

344

S=768 I=45 E=2.53046e-84

Phenylalanine dehydrogenase EC=1.4.1.20 ; NAD Oxidoreductase

Pubmed 8535000

 

prodomImg

pubmed

2

342

S=765 I=47 E=6.21168e-84

Valine dehydrogenase EC=1.4.1.- ; Branched-chain amino acid catabolism Cytoplasm NAD Oxidoreductase

Pubmed 8320231

 

prodomImg

pubmed

2

342

S=753 I=46 E=1.69159e-82

Valine dehydrogenase EC=1.4.1.- ; Branched-chain amino acid catabolism Cytoplasm NAD Oxidoreductase

Pubmed 10612726,11386345

 

prodomImg

sp_Pdown

sp|P13154|DHLE_BACST

2

364

S=1032 I=54 E=1.5286e-116

Leucine dehydrogenase EC=1.4.1.9 ; Branched-chain amino acid catabolism NAD Oxidoreductase

sp_Pdown

sp|Q53560|DHLE_BACLI

2

343

S=985 I=53 E=8.55475e-111

Leucine dehydrogenase EC=1.4.1.9 ; Branched-chain amino acid catabolism NAD Oxidoreductase

sp_Pdown

sp|P0A392|DHLE_BACCR

2

345

S=978 I=53 E=5.92668e-110

Leucine dehydrogenase EC=1.4.1.9 ; Branched-chain amino acid catabolism NAD Oxidoreductase

sp_Pdown

sp|P0A393|DHLE_BACCE

2

345

S=978 I=53 E=5.92668e-110

Leucine dehydrogenase EC=1.4.1.9 ; Branched-chain amino acid catabolism NAD Oxidoreductase

sp_Pdown

sp|Q60030|DHLE_THEIN

2

349

S=977 I=52 E=8.69797e-110

Leucine dehydrogenase EC=1.4.1.9 ; Branched-chain amino acid catabolism NAD Oxidoreductase

Iprscan [G3DSA:3.40.192.10]

2

160

-

Iprscan IPR016211 [PIRSF000188]

1

355

Glutamate/phenylalanine/leucine/valine dehydrogenase, bacterial/archaeal

Iprscan IPR006097 [PF02812]

11

133

Glutamate/phenylalanine/leucine/valine dehydrogenase, dimerisation region

Iprscan IPR006096 [PF00208]

141

350

Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal

Iprscan IPR006096 [SM00839]

143

350

Glutamate/phenylalanine/leucine/valine dehydrogenase, C-terminal

Iprscan IPR006095 [PS00074]

73

86

Glutamate/phenylalanine/leucine/valine dehydrogenase

PD713768

123

178

S=292 I=100 E=6.13978e-28

PD692119

1

65

S=243 I=69 E=6.3259e-22

PD861663

275

348

S=194 I=51 E=4.67956e-16

PDA04949

37

205

S=179 I=33 E=3.59654e-14

PDA4G223

179

272

S=145 I=36 E=5.16972e-10

PD186465

186

267

S=109 I=37 E=1.08111e-05

PD149863

66

154

S=103 I=41 E=5.33089e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one qJA3tPHJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

62 hits
swiss-prot

Swiss-Prot ncbi-blastp

47 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLEVyRz/XFF4834R_chr31500.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLEVyRz/XFF4834R_chr31500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLEVyRz/XFF4834R_chr31500.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBLEVyRz/XFF4834R_chr31500.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.