Xanthomonas fuscans subsp. fuscans

6 hits

  1. XFF4834R_chr09160XFF4834R_chr09750254_1056039_r1_XFF4834R-XFF4834R_chr09160XFF4834R_chr09160putative N-formylglutamate amidohydrolase
  2. XFF4834R_chr28680XFF4834R_chr31230591_3301961_r2_XFF4834R-XFF4834R_chr28680XFF4834R_chr28680putative N-formimino-L-glutamate deiminase
  3. XFF4834R_chr28690hutIXFF4834R_chr28690probable imidazolonepropionase
  4. XFF4834R_chr28700hutHXFF4834R_chr28700probable histidine ammonia-lyase
  5. XFF4834R_chr28710hutGXFF4834R_chr28710probable N-formylglutamate amidohydrolase HutG
  6. XFF4834R_chr28720hutUXFF4834R_chr28720probable urocanate hydratase HutU

XFF4834R_chr09750254_1056039_r1_XFF4834R-XFF4834R_chr09160 XFF4834R_chr09160
XFF4834R_chr09150
XFF4834R_chr09150
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09170
XFF4834R_chr09170
ID XFF4834R_chr09750254_1056039_r1_XFF4834R-XFF4834R_chr09160
AC XFF4834R_chr09160
LT XFF4834R_chr09160
OR XFF4834R_chr from 1055254 to 1056039 on strand -
DE putative N-formylglutamate amidohydrolase
IP N-formylglutamate amidohydrolase; Uncharacterized conserved protein UCP029730
CL 1.1.3.11 Histidine degradation GO:0006548
EC
GO InterPro


Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120329)
MW 28593.1 Da
SQ 261 aa
 
........10........20........30........40........50
| | | | |
MADAAMEPLLGTDDPAPFTVHNAQAASPWLLIADHAGQRVPARLADLGLP
QYELDRHIGWDIGIAQVTRLLAEALDAFAIAQTYSRLVIDCNRPHDAPSL
MPVVSDGTLVPGNQHLTDSDRQQRIDAIFAPYHARIAAELEARAQRNQPT
VLVSMHSFTPVMAGNARPWHAGVLYHRDTRLAHRLLQALREEPDLVVGDN
QPYAVSDATDYAIPAYGEGRGLLHVELEIRQDLIADAAGQQAWAARLARI
LPPLAHALLLR
Show or not Domain decomposition
 
XFF4834R

YP_362677.1 lcl|XCV0946

1

234

S=1153 I=95 E=1.00681e-132

putative N-formylglutamate amidohydrolase

XFF4834R

NP_641262.1 lcl|XAC0910-XAC0910

20

234

S=1097 I=98 E=6.03659e-126

hypothetical protein

XFF4834R

NP_636228.1 lcl|XCC0837

8

234

S=1011 I=87 E=1.54844e-115

hypothetical protein

XFF4834R

lcl|XALc_0463

2

234

S=822 I=68 E=1.35621e-92

putative n-formylglutamate amidohydrolase protein

pubmed

18

234

S=347 I=34 E=1.39699e-33

Riorf59 protein ; Plasmid

Pubmed 10907845,11273700

 

prodomImg

pubmed

28

234

S=337 I=40 E=2.23513e-32

Orf3; putative

Pubmed 9244287

 

prodomImg

pubmed

30

234

S=289 I=31 E=1.66791e-26

Putative uncharacterized protein ipuJ

Pubmed 11976110

 

prodomImg

Iprscan IPR011227 [PIRSF029730]

1

258

Uncharacterised conserved protein UCP029730

Iprscan IPR007709 [PF05013]

26

236

N-formylglutamate amidohydrolase

Iprscan [seg]

235

261

-

PD117136

30

233

S=294 I=41 E=3.88358e-28

PDA3D8C9

1

29

S=129 I=86 E=3.35105e-08

PD665280

8

29

S=103 I=86 E=5.64005e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one i530Cux6)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

3 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr09160.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr09160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr09160.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr09160.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr31230591_3301961_r2_XFF4834R-XFF4834R_chr28680 XFF4834R_chr28680
XFF4834R_chr28670
XFF4834R_chr28670
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28690
XFF4834R_chr28690
ID XFF4834R_chr31230591_3301961_r2_XFF4834R-XFF4834R_chr28680
AC XFF4834R_chr28680
LT XFF4834R_chr28680
OR XFF4834R_chr from 3300591 to 3301961 on strand -
DE putative N-formimino-L-glutamate deiminase
IP Formiminoglutamate deiminase
CL 1.1.3.11 Histidine degradation GO:0006548
EC
GO InterPro
Molecular Function: hydrolase activity (GO:0016787)
acting on carbon-nitrogen (but not peptide) bonds (GO:0016810)

Curated
PM
AN In some species, histidine utilisation goes via urocanate to glutamate in four step, the last being removal of formamide. This entry describes an alternate fourth step, formiminoglutamate hydrolase, which leads to N-formyl-L-glutamate. This product may be acted on by formylglutamate amidohydrolase (IPR010247) and bypass glutamate as a product during its degradation. Alternatively, removal of formate (by EC: 3.5.1.68) would yield glutamate.
CC COG: [FR] Nucleotide transport and metabolism;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 48852 Da
SQ 456 aa
 
........10........20........30........40........50
| | | | |
MADQQMQVFWAARALLPDGWASGVRIEVVQGRIGAVQVDAPAALTDTRCD
VVLPGLGNLHSHAFQRGMAGLTEVGGRSGDSFWSWRELMYRFVDRLDPDS
LQAIAEQAYVEMLESGFTRVGEFHYLHHAASGAPYAQAGEMSERIAAAAA
STGIGLSLLPVFYAHSDFGGAAPSPAQRRLIHDVDGFARLLDDCRHSLKA
LPDAVLGLAPHSLRAVTPQQLAALVPLTDGPIHLHIAEQQREVDACLAWS
RQRPVQWLLANAPVDARWCLVHATHVDARELQAIVTSGAVVGLCPITEAN
LGDGVFPMQAFAAAGGRFGVGSDSNVLIDAAEELRLLEYGQRLTLQARNV
LAQGPVSSGRWLYGQAGIGAAQALGVAHTGIRTGAAADLIELDTAHPALL
ARSDDALLDSWLFAARATAVRNVWRGGRWVVRNGQHVDRARIATRFAAVL
RSLLGQ
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr23890 lcl|XFF4834R_chr26060767_2756116_r3_XFF4834R-XFF4834R_chr23890

209

307

S=96 I=28 E=5.27796e-05

XFF4834R

NP_641971.1 lcl|sdeB-XAC1639

6

456

S=1912 I=84 E=0

N-formimino-L-glutamate deiminase

XFF4834R

YP_363411.1 lcl|XCV1680

1

456

S=1886 I=81 E=0

N-formimino-L-glutamate deiminase

XFF4834R

NP_636952.2 lcl|sdeB-XCC1580

6

454

S=1635 I=73 E=0

N-formimino-L-glutamate deiminase

XFF4834R

lcl|XALc_1715

9

454

S=1414 I=63 E=4.48542e-164

putative metalo_dependent_hydrolase protein

XFF4834R

lcl|XALc_1920

209

307

S=102 I=29 E=3.69515e-05

hypothetical n-ethylammeline chlorohydrolase protein

XFF4834R

NP_637625.1 lcl|XCC2270

209

307

S=101 I=29 E=5.10191e-05

N-ethylammeline chlorohydrolase

Iprscan [G3DSA:3.20.20.140]

55

378

-

Iprscan IPR010252 [PTHR11271:SF4]

50

448

Formiminoglutamate deiminase

Iprscan [PTHR11271]

50

448

-

Iprscan IPR006680 [PF01979]

51

390

Amidohydrolase 1

Iprscan IPR010252 [TIGR02022]

6

455

Formiminoglutamate deiminase

Iprscan [seg]

310

321

-

Iprscan [seg]

364

377

-

Iprscan [seg]

398

412

-

Iprscan [seg]

420

434

-

Iprscan [SignalP-NN(euk)]

1

21

-

Iprscan [SSF51556]

55

379

-

Iprscan IPR011059 [SSF51338]

358

455

Metal-dependent hydrolase, composite domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Em7W48tx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

2 hits
swiss-prot

Swiss-Prot ncbi-blastp

7 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28680.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28680.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28680.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
hutI XFF4834R_chr28690
XFF4834R_chr28680
XFF4834R_chr28680
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28700
XFF4834R_chr28700
ID hutI
AC XFF4834R_chr28690
LT XFF4834R_chr28690
OR XFF4834R_chr from 3302022 to 3303227 on strand +
DE probable imidazolonepropionase
IP Imidazolonepropionase; D-hydantoinase
CL 1.1.3.11 Histidine degradation GO:0006548
EC
GO InterPro
Biological Process: histidine catabolic process to glutamate and formamide (GO:0019556)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: hydrolase activity (GO:0016787)
acting on carbon-nitrogen (but not peptide) bonds (GO:0016810)
in cyclic amides (GO:0016812)

Curated
PM
AN
CC COG: [Q] Secondary metabolites biosynthesis, transport and catabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 42483.1 Da
SQ 401 aa
 
........10........20........30........40........50
| | | | |
MHCDVLWHNAQLMTLDAAAGGLGIVDDGIVACRHGHIVYAGAAAQAPALQ
PDSAHDCQRRWISPGLIDCHTHLVYAGNRANEFEQRLRGASYADIAAAGG
GIVATVRATRAADDAALLAASLPRLDAMLAEGVTTLEIKSGYGLTLDDEI
KQLRVARQLAALRNVEVVPTFLGAHAVPPGGQAQHYIDQVCTQMIPAIAA
QGLAEAVDVFCEHLAFSQAQAEQVFIAAQAHGLRIKIHAEQLSNQHGAEL
AARYGALSADHIEYLDQAGVAAMATAGTVAVLLPGAFYFTRDTQLPPIAA
LRTAGVPLALATDCNPGTSPLTSPLLAMNMAATLFRMTVDECIAGFTREA
ARALGRSERLGQLRAGMDCDLAIWNIDAPADLVYRMGFNPLHARVWRGHL
C
XFF4834R

YP_363410.2 lcl|hutI-XCV1679

1

401

S=1708 I=83 E=0

imidazolonepropionase

XFF4834R

NP_641970.2 lcl|hutI-XAC1638

1

401

S=1686 I=83 E=0

imidazolonepropionase

XFF4834R

NP_636951.2 lcl|hutI-XCC1581

1

401

S=1563 I=76 E=0

imidazolonepropionase

XFF4834R

lcl|hutI-XALc_1716

1

399

S=1356 I=68 E=4.22115e-157

probable imidazolonepropionase (imidazolone-5-propionatehydrolase) protein

pubmed

6

399

S=947 I=50 E=6.38731e-106

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Plasmid Zinc

Pubmed 11481431

 

prodomImg

pubmed

6

399

S=911 I=47 E=1.15173e-101

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Plasmid Zinc

Pubmed 10907845,11273700

 

prodomImg

pubmed

1

397

S=849 I=47 E=4.23435e-94

Imidazolonepropionase EC=3.5.2.7 ; Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17564599

 

prodomImg

pubmed

5

401

S=520 I=32 E=2.9403e-54

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 7704263

 

prodomImg

pubmed

60

396

S=511 I=36 E=3.49751e-53

HutI ; Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 11133460,15240299

 

prodomImg

pubmed

56

389

S=465 I=33 E=1.33373e-47

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17592475

 

prodomImg

pubmed

56

400

S=463 I=32 E=2.70256e-47

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 18524787

 

prodomImg

pubmed

56

401

S=439 I=32 E=1.75852e-44

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17107561

 

prodomImg

pubmed

56

387

S=436 I=33 E=4.35456e-44

Probable imidazolonepropionase EC=3.5.2.7 ; Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 17615350

 

prodomImg

pubmed

125

400

S=385 I=33 E=7.37472e-38

Probable imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Pubmed 7927711

 

prodomImg

sp_Pdown

sp|Q3BV03|HUTI_XANC5

1

401

S=1708 I=83 E=0

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

sp_Pdown

sp|Q8PLZ7|HUTI_XANAC

1

401

S=1686 I=83 E=0

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

sp_Pdown

sp|Q5H071|HUTI_XANOR

1

401

S=1645 I=80 E=0

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

sp_Pdown

sp|B2SJI1|HUTI_XANOP

1

401

S=1641 I=80 E=0

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

sp_Pdown

sp|Q2P345|HUTI_XANOM

1

401

S=1641 I=80 E=0

Imidazolonepropionase EC=3.5.2.7 ; Cytoplasm Histidine metabolism Hydrolase Iron Metal-binding Zinc

Iprscan [G3DSA:3.20.20.140]

65

358

-

Iprscan IPR005920 [MF_00372]

4

401

Imidazolonepropionase

Iprscan [PTHR22642]

24

398

-

Iprscan IPR006680 [PF01979]

62

375

Amidohydrolase 1

Iprscan IPR005920 [TIGR01224]

25

400

Imidazolonepropionase

Iprscan [seg]

40

54

-

Iprscan [seg]

88

120

-

Iprscan [seg]

268

281

-

PD014595

128

212

S=277 I=63 E=4.16022e-26

PD690291

210

289

S=210 I=56 E=5.36796e-18

PD891632

293

364

S=196 I=56 E=2.88564e-16

PDA0Q5L3

1

29

S=130 I=83 E=2.42883e-08

Iprscan [SSF51556]

65

359

-

Iprscan IPR011059 [SSF51338]

1

401

Metal-dependent hydrolase, composite domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one v5EjspyA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

22 hits
swiss-prot

Swiss-Prot ncbi-blastp

257 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28690.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28690.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28690.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
hutH XFF4834R_chr28700
XFF4834R_chr28690
XFF4834R_chr28690
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_3028
XFF4834R_chr_3028
ID hutH
AC XFF4834R_chr28700
LT XFF4834R_chr28700
OR XFF4834R_chr from 3303241 to 3304782 on strand +
DE probable histidine ammonia-lyase
IP Phenylalanine/histidine ammonia-lyase; Histidine ammonia-lyase; L-Aspartase-like
CL 1.1.3.11 Histidine degradation GO:0006548
EC
GO InterPro
Biological Process: biosynthetic process (GO:0009058)
Biological Process: histidine catabolic process (GO:0006548)
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: ammonia ligase activity (GO:0016211)
Molecular Function: histidine ammonia-lyase activity (GO:0004397)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 53202.5 Da
SQ 513 aa
 
........10........20........30........40........50
| | | | |
MSVSVVLQPGQVTLAQWRALYRGAEVALDDACAAAVLRSAQTVEAIVARG
EPVYGVNTGFGKLASVRIEREDLQALQRNIVLSHAAGVGEPTPVPVVRLM
MALKLTSLAQGASGVQPDTLALLDAMLRAGITPVVPCQGSVGASGDLAPL
SHLAAVMIGVGEAFVGAQRLPAADALAHAQLQPRVLGAKEGLALLNGTQF
STACALAGLFEIETILQAALVTGALSVEAAKGSDTPFDARIHALRGQPGQ
IATAAALRALMADSAIRESHRLGDVRVQDPYCLRCQPQVMGAALDVMRQA
ARTLEIEANGVSDNPLVFSDTSEALSGGNFHAEPVAFAADMLAMAVCEIG
SISERRTAMLVDPALSGLPAFLTPRPGLNSGFMIPQVTAAALVSENKQRA
YPASVDSIPTSANQEDHVSMAAHGARRLLAMAENAAHVIGIELLAAVQGC
DFHAPLRSSTALEAARALLRAQVPTLQDDRYFHPDMLVASALVRSGALAQ
AVAVPLPGVEQDV
pubmed

3

499

S=1633 I=68 E=0

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

Pubmed 18700039

 

prodomImg

pubmed

3

503

S=1400 I=57 E=1.07455e-160

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism Plasmid

Pubmed 10907845,11273700

 

prodomImg

pubmed

3

511

S=1386 I=56 E=4.72682e-159

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism Plasmid

Pubmed 11481431

 

prodomImg

pubmed

39

507

S=1246 I=58 E=4.701e-142

Histidine ammonia-lyase EC=4.3.1.3 ; metabolism

Pubmed 17564599

 

prodomImg

pubmed

5

498

S=1174 I=51 E=2.09203e-133

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

Pubmed 2332400,8239649

 

prodomImg

pubmed

39

498

S=1130 I=54 E=4.5264e-128

Histidine ammonia-lyase EC=4.3.1.3 ; metabolism

Pubmed 11133432

 

prodomImg

pubmed

43

502

S=1064 I=49 E=4.41854e-120

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

Pubmed 11182319

 

prodomImg

pubmed

38

486

S=975 I=45 E=2.98321e-109

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

Pubmed 2454913,7704263

 

prodomImg

pubmed

53

502

S=897 I=49 E=8.28375e-100

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

Pubmed 17965706

 

prodomImg

pubmed

146

502

S=870 I=52 E=1.77972e-96

HutH ; Histidine metabolism Lyase Plasmid

Pubmed 12620823

 

prodomImg

sp_Pdown

sp|Q8PLZ8|HUTH_XANAC

1

513

S=2367 I=90 E=0

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

sp_Pdown

sp|Q8PAA7|HUTH_XANCP

1

510

S=2277 I=88 E=0

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

sp_Pdown

sp|B0RUX3|HUTH_XANCB

1

510

S=2277 I=88 E=0

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

sp_Pdown

sp|Q4UTB9|HUTH_XANC8

1

510

S=2277 I=88 E=0

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

sp_Pdown

sp|B0SYU6|HUTH_CAUSK

3

510

S=1855 I=72 E=0

Histidine ammonia-lyase EC=4.3.1.3 ; Cytoplasm metabolism

Iprscan [G3DSA:1.10.275.10]

3

197

-

Iprscan [G3DSA:1.20.200.10]

198

510

-

Iprscan IPR001106 [PF00221]

5

477

Phenylalanine/histidine ammonia-lyase

Iprscan IPR005921 [TIGR01225]

5

506

Histidine ammonia-lyase

Iprscan [seg]

24

37

-

Iprscan [seg]

252

265

-

Iprscan [seg]

456

471

-

PD001290

39

498

S=1098 I=51 E=1.77021e-125

PD737272

452

510

S=177 I=63 E=8.09599e-14

PDA9Q8M1

98

317

S=132 I=21 E=2.01391e-08

Iprscan IPR008948 [SSF48557]

3

510

L-Aspartase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VwMBsddJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

124 hits
swiss-prot

Swiss-Prot ncbi-blastp

234 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

8 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28700.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28700.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28700.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
hutG XFF4834R_chr28710
XFF4834R_chr_3028
XFF4834R_chr_3028
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28720
XFF4834R_chr28720
ID hutG
AC XFF4834R_chr28710
LT XFF4834R_chr28710
OR XFF4834R_chr from 3304964 to 3305821 on strand +
DE probable N-formylglutamate amidohydrolase HutG
IP N-formylglutamate amidohydrolase; N-formylglutamate deformylase
CL 1.1.3.11 Histidine degradation GO:0006548
EC
GO InterPro


Curated
PM
AN Interpro : In some species, histidine is converted to via urocanate and then formimino-L-glutamate to glutamate in four steps, where the fourth step is conversion of N-formimino-L-glutamate to L-glutamate and formamide. In others, that pathway from formimino-L-glutamate may differ, with the next enzyme being formiminoglutamate hydrolase (HutF) yielding N-formyl-L-glutamate. This entry represents the enzyme N-formylglutamate deformylase, also called N-formylglutamate amidohydrolase, which then produces glutamate.
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120404)
MW 31971.6 Da
SQ 285 aa
 
........10........20........30........40........50
| | | | |
MNALPDWLELHRGDAPLIISFPHTGTELPEDLADQFVSPWLARRDTDWWV
HQLYDFAQGLGATTLRTAISRSVIDVNRDPSGASLYPGQNTTGLCPLTTF
DNQPLYADGAAPDQAQIALRRMRWFDPYHAALAEEIARLRAQHAKIVVYD
AHSIRSFIPHLFDGQLPQFNIGSNEDRSCDRRLVDAVERLCRSSGSSTVR
NGRFKGGWITRHYAQPEHGVHTLQMELACRGYMREPDSLTPDNWPTPWQP
VHAVALRAVLRHVLQACLHFANAPSSDTAPPAANR
XFF4834R

YP_363408.1 lcl|hutG-XCV1677

1

285

S=1403 I=92 E=4.79059e-163

N-formylglutamate amidohydrolase

XFF4834R

NP_641968.1 lcl|hutG-XAC1636

1

285

S=1395 I=92 E=5.26839e-162

formylglutamate amidohydrolase

XFF4834R

NP_636949.1 lcl|hutG-XCC1578

1

285

S=1145 I=76 E=9.21497e-132

formylglutamate amidohydrolase

XFF4834R

lcl|hutG-XALc_1718

1

280

S=1010 I=67 E=2.15553e-115

probable n-formylglutamate_deformylase protein

pubmed

9

264

S=542 I=44 E=3.86189e-57

Riorf41 protein ; Plasmid

Pubmed 10907845,11273700

 

prodomImg

Iprscan IPR007709 [PF05013]

15

233

N-formylglutamate amidohydrolase

Iprscan IPR010247 [TIGR02017]

6

273

N-formylglutamate deformylase

Iprscan [seg]

130

141

-

PD117136

17

235

S=324 I=37 E=9.89405e-32

PDA92322

236

285

S=250 I=96 E=8.61613e-23

PDA9C6Y4

16

129

S=142 I=31 E=1.14641e-09

PDA1G6N3

162

208

S=141 I=56 E=1.47621e-09

PD123728

208

273

S=131 I=47 E=1.91593e-08

PD463862

10

51

S=126 I=60 E=8.58339e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one f7qM7oO4)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

1 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

3 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28710.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28710.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28710.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
hutU XFF4834R_chr28720
XFF4834R_chr28710
XFF4834R_chr28710
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr28730
XFF4834R_chr28730
ID hutU
AC XFF4834R_chr28720
LT XFF4834R_chr28720
OR XFF4834R_chr from 3305838 to 3307505 on strand +
DE probable urocanate hydratase HutU
IP Urocanase
CL 1.1.3.11 Histidine degradation GO:0006548
EC
GO InterPro
Biological Process: histidine catabolic process (GO:0006548)
Molecular Function: urocanate hydratase activity (GO:0016153)

Curated
PM
AN Interpro : Urocanase [1] (also known as imidazolonepropionate hydrolase or urocanate hydratase) is the enzyme that catalyzes the second step in the degradation of histidine, the hydration of urocanate into imidazolonepropionate. urocanate + H2O = 4,5-dihydro-4-oxo-5-imidazolepropanoate Urocanase is found in some bacteria (gene hutU), in the liver of many vertebrates and has also been found in the plant Trifolium repens (white clover). Urocanase is a protein of about 60 Kd, it binds tightly to NAD+ and uses it as an electrophil cofactor. A conserved cysteine has been found to be important for the catalytic mechanism and could be involved in the binding of the NAD+.
CC COG: [E] Amino acid transport and metabolism;
CC MODEL: acur
CC STATUS: curated by darrasse (20120404)
MW 60054.8 Da
SQ 555 aa
 
........10........20........30........40........50
| | | | |
MTRHDATRVIRAATGTTLTAKSWLTEAPLRMLMNNLDPDVAERPQELVVY
GGIGRAARDWESFDAIVAALTRLDEDQTLLVQSGKPVGVFRTHADAPRVL
IANSNLVPRWANWDHFNALDKKGLAMYGQMTAGSWIYIGAQGIVQGTYET
FVEMGRQHYAGNLAGKWLFTGGLGGMGGAQPLAAVMAGASCLAVECRRSS
IDMRLRTGYLDTWTDSLDDALRLIEESCTARKPLSVGLLGNVADVLDELL
LRGIKPDLLTDQTSAHDPVNGYLPQGWSVEEWDAKRMSAPKEVEAAARDS
MANHIRAMLAFHALGVPTVDYGNNLRQMALEAGVDDAFDFPGFVPAYIRP
LFCRGIGPFRWVALSGDPDDIAKTDAKVKELIPDDAHLHRWLDMAAEKIA
FQGLPARICWVGLGDRHRLGLAFNAMVRSGELKAPVVIGRDHLDSGSVAS
PNRETEAMADGSDAVSDWPLLNALLNTASGATWVSLHHGGGVGMGFSQHA
GMVIVCDGSQAADRRLERVLWNDPATGVMRHADAGYAIATDCAKEKGLDL
PGIVR
Show or not Domain decomposition
 
pubmed

1

554

S=2290 I=77 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

Pubmed 18700039

 

prodomImg

pubmed

3

554

S=2216 I=75 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD Plasmid

Pubmed 11481431

 

prodomImg

pubmed

3

554

S=2114 I=73 E=0

Riorf42 protein ; Histidine metabolism Lyase NAD Plasmid

Pubmed 10907845,11273700

 

prodomImg

pubmed

10

554

S=2089 I=72 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

Pubmed 1677899,7901006

 

prodomImg

pubmed

1

553

S=2064 I=70 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD Stress response

Pubmed 11772602

 

prodomImg

pubmed

8

551

S=2037 I=70 E=0

Urocanate hydratase EC=4.2.1.49 ; Histidine metabolism Lyase NAD

Pubmed 1356832

 

prodomImg

pubmed

6

551

S=1979 I=69 E=0

Urocanase EC=4.2.1.49 ; Histidine metabolism Lyase NAD

Pubmed 17564599

 

prodomImg

pubmed

8

553

S=1771 I=59 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

Pubmed 15590099

 

prodomImg

pubmed

5

551

S=1754 I=61 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

Pubmed 7704263

 

prodomImg

pubmed

8

551

S=1719 I=58 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

Pubmed 19124572

 

prodomImg

sp_Pdown

sp|P58987|HUTU_XANAC

1

555

S=2738 I=94 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

sp_Pdown

sp|Q3BV06|HUTU_XANC5

1

555

S=2734 I=93 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

sp_Pdown

sp|P58988|HUTU_XANCP

1

554

S=2698 I=92 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

sp_Pdown

sp|B4SP57|HUTU_STRM5

1

554

S=2523 I=86 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

sp_Pdown

sp|B2FKG1|HUTU_STRMK

1

554

S=2522 I=86 E=0

Urocanate hydratase EC=4.2.1.49 ; Cytoplasm Histidine metabolism Lyase NAD

Iprscan IPR000193 [PIRSF001423]

6

555

Urocanase

Iprscan IPR000193 [PF01175]

10

552

Urocanase

Iprscan IPR000193 [TIGR01228]

8

552

Urocanase

Iprscan [seg]

164

184

-

PD025423

10

551

S=1961 I=67 E=0

Iprscan IPR000193 [SSF111326]

2

555

Urocanase

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one UE4Xt2SR)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

15 hits
swiss-prot

Swiss-Prot ncbi-blastp

152 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28720.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28720.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBy5GnYh/XFF4834R_chr28720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.