Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr31520atoBXFF4834R_chr31520probable acetyl-CoA C-acetyltransferase

atoB XFF4834R_chr31520
XFF4834R_chr31510
XFF4834R_chr31510
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr31530
XFF4834R_chr31530
ID atoB
AC XFF4834R_chr31520
LT XFF4834R_chr31520
OR XFF4834R_chr from 3621398 to 3622573 on strand +
DE probable acetyl-CoA C-acetyltransferase
IP Thiolase; Thiolase-like
CL 1.1.2.7 Acetoacetate degradation
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN atoB chez xcc et xac. thlA chez xav mais chez coli c est atoB 46% homologie avec XFF4834R3333,, paralogue paaJ?
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100902)
MW 39817 Da
SQ 391 aa
 
........10........20........30........40........50
| | | | |
MSDIVIVAAKRTAIGSFLGQFNAVPAPTLAAAAIQGALAQSGIAPADISE
VIVGCVLPANLGQAPARQAAIAAGIPTSTGATTINKVCGSGMKAIMLGHD
LIKAGSASIVVAGGMESMSNAPHLLPNSRTGNRYGNFQAVDHMAWDGLTN
PYDGQAMGVFGEATAEKFGFSRADQDAFAIASVERAQAAQRSGAFAEEIV
PVTVATRKGEVVVDSDEQPGKSDVAKIPTLKPAFKKDGSVTAASSSSISD
GAAITVLMSADDAQRRGLTPLARIVGHVTHAQEPEWFTTAPVAAIQSLVS
KLGWRLDDVDLFEINEAFAVVAMAPISQLGIAHDKVNVHGGACALGHPIG
ASGARLVVTLVNALRSRGGKRGIATLCIGGGEATAIAIELI
XFF4834R

XFF4834R_chr03500 paaJ-XFF4834R_chr03500

1

391

S=472 I=34 E=1.38892e-50

predicted beta-ketoadipyl CoA thiolase

XFF4834R

XFF4834R_chr21150 XFF4834R_chr23020837_2455042_r3_XFF4834R-XFF4834R_chr21150

48

389

S=425 I=35 E=7.63869e-45

XFF4834R

XFF4834R_chr01840 fadI-XFF4834R_chr01840

79

389

S=229 I=27 E=3.59955e-21

beta-ketoacyl-CoA thiolase, anaerobic, subunit

XFF4834R

YP_363132.1 thlA-XCV1401

1

391

S=1680 I=84 E=0

acetyl-CoA C-acetyltransferase

XFF4834R

NP_641683.1 atoB-XAC1348

1

391

S=1679 I=84 E=0

acetoacetyl-CoA thiolase

XFF4834R

NP_636671.1 atoB-XCC1297

1

391

S=1606 I=80 E=0

acetoacetyl-CoA thiolase

XFF4834R

XALc_2525 atoB-XALc_2525

1

391

S=1434 I=71 E=1.41025e-166

probable acetyl-coa c-acetyltransferase protein

XFF4834R

NP_635761.1 pcaF-XCC0366

1

391

S=497 I=34 E=4.62307e-53

beta-ketoadipyl CoA thiolase

XFF4834R

XALc_3031 pcaF-XALc_3031

1

391

S=488 I=35 E=5.49918e-52

probable beta-ketoadipyl coa thiolase protein

XFF4834R

YP_362111.1 pcaF-XCV0380

1

391

S=479 I=34 E=7.39054e-51

beta-ketoadipyl CoA thiolase

XFF4834R

NP_640722.1 pcaF-XAC0366

1

391

S=469 I=34 E=1.06499e-49

beta-ketoadipyl CoA thiolase

XFF4834R

XALc_1595 fadA-XALc_1595

1

389

S=443 I=34 E=1.57272e-46

probable acetyl-coa c-acyltransferase protein

XFF4834R

NP_642338.1 fadA-XAC2012

48

389

S=428 I=36 E=9.89103e-45

acetyl-CoA acetyltransferase

XFF4834R

YP_363794.1 fadA-XCV2063

48

389

S=427 I=35 E=1.50312e-44

acetyl-CoA acetyltransferase

XFF4834R

NP_637343.1 fadA-XCC1978

48

389

S=426 I=35 E=2.18682e-44

acetyl-CoA acetyltransferase

XFF4834R

NP_635589.1 yfcY-XCC0194

48

389

S=233 I=26 E=4.86859e-21

acetyl-CoA acetyltransferase

XFF4834R

YP_361929.1 XCV0198

79

389

S=230 I=27 E=9.36248e-21

acetyl-CoA acetyltransferase

XFF4834R

NP_640569.1 yfcY-XAC0213

79

389

S=229 I=27 E=1.29268e-20

acetyl-CoA acetyltransferase

XFF4834R

XALc_3086 XALc_3086

79

389

S=223 I=26 E=7.92656e-20

putative acetyl-coa c-acyltransferase protein

pubmed

2

391

S=986 I=53 E=1.06975e-110

3-ketoacyl-CoA thiolase

Pubmed 15608629

 

prodomImg

pubmed

4

391

S=903 I=48 E=1.33078e-100

FadAx

Pubmed 11251808

 

prodomImg

pubmed

1

389

S=778 I=43 E=1.72205e-85

Acetyl-CoA acetyltransferase EC=2.3.1.9 ; Acyltransferase Cytoplasm

Pubmed 7867955,11075929

 

prodomImg

pubmed

3

391

S=747 I=42 E=9.99615e-82

Probable acetyl-CoA acetyltransferase, cytosolic 2 EC=2.3.1.9 ; Acyltransferase Alternative splicing Cytoplasm Metal-binding Potassium

Pubmed 10048488

 

prodomImg

pubmed

3

389

S=742 I=45 E=3.9637e-81

Acetyl-CoA acetyltransferase EC=2.3.1.9 ; Acyltransferase Cytoplasm PHA biosynthesis

Pubmed 10427049

 

prodomImg

sp_Pdown

acc=P45359

1

389

S=778 I=43 E=1.1712e-85

Acetyl-CoA acetyltransferase EC=2.3.1.9 ; Acyltransferase Cytoplasm

sp_Pdown

acc=Q9FIK7

3

391

S=747 I=42 E=6.79858e-82

Probable acetyl-CoA acetyltransferase, cytosolic 2 EC=2.3.1.9 ; Acyltransferase Alternative splicing Cytoplasm Metal-binding Potassium

sp_Pdown

acc=Q9ZHI1

3

389

S=742 I=45 E=2.69579e-81

Acetyl-CoA acetyltransferase EC=2.3.1.9 ; Acyltransferase Cytoplasm PHA biosynthesis

sp_Pdown

acc=Q86AD9

1

389

S=740 I=42 E=5.5586e-81

Probable acetyl-CoA acetyltransferase EC=2.3.1.9 ; Acyltransferase Metal-binding Potassium

sp_Pdown

acc=Q9UQW6

2

391

S=728 I=41 E=1.37531e-79

Acetyl-CoA acetyltransferase EC=2.3.1.9 ; Acyltransferase Cytoplasm Metal-binding Potassium

Iprscan IPR016038 [G3DSA:3.40.47.10]

1

274

Thiolase-like, subgroup

Iprscan IPR002155 [PIRSF000429]

1

391

Thiolase

Iprscan IPR002155 [PTHR18919]

64

391

Thiolase

Iprscan IPR020616 [PF00108]

1

260

Thiolase, N-terminal

Iprscan IPR020617 [PF02803]

268

389

Thiolase, C-terminal

Iprscan IPR002155 [TIGR01930]

6

389

Thiolase

Iprscan IPR020615 [PS00098]

84

102

Thiolase, acyl-enzyme intermediate active site

Iprscan IPR020610 [PS00099]

372

385

Thiolase, active site

Iprscan [seg]

23

44

-

Iprscan [seg]

62

76

-

Iprscan [seg]

237

255

-

PD858891

336

391

S=179 I=67 E=2.99211e-14

PD985894

84

390

S=166 I=23 E=1.01327e-12

PD000785

121

185

S=154 I=48 E=3.40163e-11

PD922406

309

389

S=154 I=38 E=3.55319e-11

PDA264K2

148

236

S=152 I=42 E=6.15416e-11

PD542989

256

350

S=143 I=30 E=7.51442e-10

PDA8Z0A6

79

234

S=138 I=33 E=2.52476e-09

PDA702G0

186

235

S=121 I=50 E=3.39028e-07

PD859032

291

337

S=120 I=49 E=3.93194e-07

PDA2P1G7

92

168

S=119 I=40 E=6.18735e-07

Iprscan IPR016039 [SSF53901]

3

267

Thiolase-like

Iprscan IPR016039 [SSF53901]

268

391

Thiolase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one EhfwCSOX)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

235 hits
swiss-prot

Swiss-Prot ncbi-blastp

283 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

13 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbOyweJ/XFF4834R_chr31520.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbOyweJ/XFF4834R_chr31520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbOyweJ/XFF4834R_chr31520.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBbOyweJ/XFF4834R_chr31520.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.