Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr01840fadIXFF4834R_chr01840probable beta-ketoacyl-CoA thiolase
  2. XFF4834R_chr15840fadEXFF4834R_chr15840probable acyl coenzyme A dehydrogenase
  3. XFF4834R_chr21150fadAXFF4834R_chr21150probable acetyl-CoA acetyltransferase

fadI XFF4834R_chr01840
XFF4834R_chr01830
XFF4834R_chr01830
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01850
XFF4834R_chr01850
ID fadI
AC XFF4834R_chr01840
LT XFF4834R_chr01840
OR XFF4834R_chr from 220546 to 221841 on strand +
DE probable beta-ketoacyl-CoA thiolase
IP Thiolase; Thiolase-like
CL 1.1.2.4 Anaerobic fatty acid oxidation pathway
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN changement de start +5 aa(aligner sur autres xanth). PMID: 12535077 , publi de genprotec 39% d'homology avec fadI coli sur 96%, le nom chez xac et xcc : yfcY (ancien nom de fadI)
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100909)
MW 45559.6 Da
SQ 431 aa
 
........10........20........30........40........50
| | | | |
MPGQPMPAARPVAILGGVRIPFCRQNTAYADVGNLGMSVRTLGALVERFG
LHGQQLGEVAMGAVIKHSADWNLAREAALSSGLSPLTPGITLQRACGTSL
DSVITIANKIALGQIDSGIGGGSDTTSEVPIVYGKKLRARLLAANRAKAT
GDKLRALLRGFKLAELKPEFPGVAEPRTGKSMGDHCEDMAKEWNISRDSQ
DEWAVASHHKLAAAYERGFFDALIAPFRGVSRDNILRADTSLEKLATLRP
AFDKTSGRGTLTAANSTPLTDGAAAVLLSSEAWALAHGHTPMAYLRDAQV
AAVDFVHGEGLLMAPTIAVPQMLARQGLTLQDFDIYEIHEAFAAQVLCTL
RAWESEDYCRNRLGLDAPLGRIDPDKINPLGSSLATGHPFAATGARVVAT
AAKQLEERGGGRALISICTAGGMGVVAIVER
XFF4834R

XFF4834R_chr21150 XFF4834R_chr23020837_2455042_r3_XFF4834R-XFF4834R_chr21150

182

430

S=334 I=36 E=8.45573e-34

XFF4834R

XFF4834R_chr03500 paaJ-XFF4834R_chr03500

12

431

S=301 I=30 E=7.14096e-30

predicted beta-ketoadipyl CoA thiolase

XFF4834R

XFF4834R_chr31520 XFF4834R_chr34100398_3622573_f2_XFF4834R-XFF4834R_chr31520

172

430

S=243 I=30 E=8.02101e-23

predicted acyltransferase

XFF4834R

NP_640569.1 yfcY-XAC0213

1

431

S=2036 I=91 E=0

acetyl-CoA acetyltransferase

XFF4834R

YP_361929.1 XCV0198

1

431

S=2032 I=90 E=0

acetyl-CoA acetyltransferase

XFF4834R

NP_635589.1 yfcY-XCC0194

1

431

S=1997 I=88 E=0

acetyl-CoA acetyltransferase

XFF4834R

XALc_3086 XALc_3086

3

431

S=1813 I=80 E=0

putative acetyl-coa c-acyltransferase protein

XFF4834R

YP_363794.1 fadA-XCV2063

182

430

S=332 I=36 E=5.27433e-33

acetyl-CoA acetyltransferase

XFF4834R

NP_637343.1 fadA-XCC1978

182

430

S=332 I=36 E=5.46152e-33

acetyl-CoA acetyltransferase

XFF4834R

NP_642338.1 fadA-XAC2012

182

430

S=331 I=35 E=7.74058e-33

acetyl-CoA acetyltransferase

XFF4834R

XALc_3031 pcaF-XALc_3031

14

431

S=330 I=32 E=8.97726e-33

probable beta-ketoadipyl coa thiolase protein

XFF4834R

NP_635761.1 pcaF-XCC0366

12

431

S=323 I=30 E=6.78599e-32

beta-ketoadipyl CoA thiolase

XFF4834R

NP_640722.1 pcaF-XAC0366

12

431

S=309 I=30 E=3.43195e-30

beta-ketoadipyl CoA thiolase

XFF4834R

XALc_1595 fadA-XALc_1595

182

430

S=305 I=34 E=1.05682e-29

probable acetyl-coa c-acyltransferase protein

XFF4834R

YP_362111.1 pcaF-XCV0380

12

431

S=293 I=30 E=2.52515e-28

beta-ketoadipyl CoA thiolase

XFF4834R

YP_363132.1 thlA-XCV1401

172

430

S=252 I=31 E=2.60387e-23

acetyl-CoA C-acetyltransferase

XFF4834R

XALc_2525 atoB-XALc_2525

172

430

S=251 I=31 E=3.12706e-23

probable acetyl-coa c-acetyltransferase protein

XFF4834R

NP_641683.1 atoB-XAC1348

172

430

S=250 I=31 E=3.95706e-23

acetoacetyl-CoA thiolase

XFF4834R

NP_636671.1 atoB-XCC1297

172

430

S=244 I=30 E=2.38447e-22

acetoacetyl-CoA thiolase

pubmed

10

430

S=1015 I=53 E=4.43654e-114

PROBABLE ACETYL-CoA ACYLTRANSFERASE FADA2 (3-KETOACYL-CoA THIOLASE) (BETA-KETOTHIOLASE) EC=2.3.1.16 Thiolase EC=2.3.1.16

Pubmed 19099550

 

prodomImg

pubmed

12

430

S=633 I=36 E=7.92871e-68

Uncharacterized protein B0303.3 ; Acyltransferase

Pubmed 1538779

 

prodomImg

pubmed

7

430

S=612 I=36 E=2.52396e-65

Trifunctional enzyme subunit beta, mitochondrial EC=2.3.1.16 ; Acetylation Acyltransferase Fatty acid metabolism Lipid Mitochondrion Transit pept

Pubmed 8253773

 

prodomImg

pubmed

2

431

S=608 I=34 E=9.17245e-65

Thiolase ; Acyltransferase

Pubmed 10191082

 

prodomImg

pubmed

7

422

S=607 I=34 E=1.09198e-64

Mitochondrial trifunctional protein, beta subunit

Pubmed 12140684

 

prodomImg

sp_Pdown

sp|A1RI91|FADI_SHESW

12

430

S=684 I=38 E=3.15724e-74

3-ketoacyl-CoA thiolase EC=2.3.1.16 ; Acyltransferase Cytoplasm Fatty acid metabolism Lipid degradation

sp_Pdown

sp|A9KTW7|FADI_SHEB9

12

430

S=674 I=37 E=5.65771e-73

3-ketoacyl-CoA thiolase EC=2.3.1.16 ; Acyltransferase Cytoplasm Fatty acid metabolism Lipid degradation

sp_Pdown

sp|A3D685|FADI_SHEB5

12

430

S=674 I=37 E=5.65771e-73

3-ketoacyl-CoA thiolase EC=2.3.1.16 ; Acyltransferase Cytoplasm Fatty acid metabolism Lipid degradation

sp_Pdown

sp|B8EE97|FADI_SHEB2

12

430

S=674 I=37 E=5.65771e-73

3-ketoacyl-CoA thiolase EC=2.3.1.16 ; Acyltransferase Cytoplasm Fatty acid metabolism Lipid degradation

sp_Pdown

sp|A4Y898|FADI_SHEPC

12

430

S=671 I=37 E=1.45072e-72

3-ketoacyl-CoA thiolase EC=2.3.1.16 ; Acyltransferase Cytoplasm Fatty acid metabolism Lipid degradation

Iprscan IPR016038 [G3DSA:3.40.47.10]

8

295

Thiolase-like, subgroup

Iprscan IPR002155 [PIRSF000429]

9

431

Thiolase

Iprscan [PTHR18919:SF5]

72

431

-

Iprscan IPR002155 [PTHR18919]

72

431

Thiolase

Iprscan IPR020617 [PF02803]

290

431

Thiolase, C-terminal

Iprscan IPR020616 [PF00108]

11

281

Thiolase, N-terminal

Iprscan IPR002155 [TIGR01930]

14

430

Thiolase

PD721696

6

87

S=216 I=56 E=1.17042e-18

PDA5L2P0

170

280

S=167 I=36 E=1.06733e-12

PDA1U529

355

380

S=148 I=100 E=2.17805e-10

PD859032

313

378

S=140 I=44 E=2.01199e-09

PD032470

211

257

S=125 I=50 E=1.222e-07

PDA1U6C2

150

175

S=123 I=92 E=1.85705e-07

PDA8Z0A6

188

253

S=118 I=38 E=8.1048e-07

PDA264K2

161

257

S=112 I=35 E=4.55481e-06

PDA1L9N0

352

378

S=110 I=70 E=8.68303e-06

PDA6U1F2

346

378

S=108 I=64 E=1.28548e-05

Iprscan IPR016039 [SSF53901]

288

431

Thiolase-like

Iprscan IPR016039 [SSF53901]

11

288

Thiolase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 3oJQDsVU)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

209 hits
swiss-prot

Swiss-Prot ncbi-blastp

286 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

9 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr01840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr01840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr01840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr01840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
fadE XFF4834R_chr15840
XFF4834R_chr15830
XFF4834R_chr15830
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15850
XFF4834R_chr15850
ID fadE
AC XFF4834R_chr15840
LT XFF4834R_chr15840
OR XFF4834R_chr from 1828430 to 1830904 on strand -
DE probable acyl coenzyme A dehydrogenase
IP Acyl-CoA oxidase/dehydrogenase, type1/2, C-terminal; Acyl-CoA dehydrogenase/oxidase, N-terminal; Pimeloyl-CoA dehydrogenase, small subunit
CL 1.1.2.4 Anaerobic fatty acid oxidation pathway
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: fatty acid beta-oxidation using acyl-CoA dehydrogenase (GO:0033539)
Molecular Function: FAD binding (GO:0050660)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: acyl-CoA dehydrogenase activity (GO:0003995)
acting on the CH-CH group of donors (GO:0016627)

Curated
PM
AN chez genprotec fadE et fadF sont synonymes j ai garde E pour etre comme autres xantho
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100810)
MW 89447 Da
SQ 824 aa
 
........10........20........30........40........50
| | | | |
MSIIAPFLLVVLAAGIAAYHRMRLATWVAISACVLVACWLLGANLTATIV
AAALVVLISAPVLLPFLRKPLLTTPLMGFFRKVLPPLSQTERIALETGSV
GFEGELFTGDPDWQKLLNYPKPQLTAEEQAFLDGPVEELCKMINDWEITH
VHADLPPELWDFIKKNKFFGMIIPKQYGGLGFSALAHHKVIQKLSSISSV
VSSTVGVPNSLGPGELLLHYGTPEQKDYYLPRLAVGAEVPCFGLTGPFAG
SDATSIPDYGIVCKGEWNGANVLGVKLTFDKRYITLAPVASLIGLAFRAY
DPDGLIGDKKDIGITLALLPRETPGVEIGRRHFPLNSPFQNGPIHGEEVF
IPLSQLIGGVEMVGKGWNMLNECLAVGRSITLPSTASGGSKAAAVVTGAY
ARIRKQFGLSVGRFEGVEEALARIGGKAYAISALSQATAAAVDRGDVPSV
PSAIAKYHCTTMGREVVSDMMDVIGGKGIILGPRNFAGRAWQAAPIGVTV
EGANIMTRSLLIFGQGAILCHPWVLKEMQAAQDPDTRRGLEQFDQSLFGH
IRFGISNAVRSFWFGLTGARLGAAPGDAYTRRFFRKLDRYSANLALMADV
SMLMLGGKLKFKESLSGRLGDVLSHIYMTSAILKRYHDEGAPASDQPLLA
WAFHDSVHKIETALSAALRNFPIRPVGWLMWVLIFPLGRRAEAPGDRLGH
RVASLLMTPNEARDRLAKGVFLTPCANNPGGRIASYLTKAVMAEPVERKF
LKALKTKGIEALDFPAQLDEAVAEGVISMEERKLLEELREIMMDTITVDD
FDPHELRAASFYDKPQMQQPREAA
XFF4834R

XFF4834R_chr29520 lcl|XFF4834R_chr_3391021_3392217_r1_XFF4834R-XFF4834R_chr29520

154

478

S=160 I=24 E=1.74715e-12

predicted acyl-CoA dehydrogenase

XFF4834R

XFF4834R_chr02380 lcl|caiA-XFF4834R_chr02380

155

511

S=118 I=23 E=2.57579e-07

crotonobetaine reductase subunit II, FAD-binding

XFF4834R

NP_643363.1 lcl|fadE-XAC3054

1

824

S=3983 I=92 E=0

acyl-CoA dehydrogenase

XFF4834R

YP_364921.1 lcl|fadE-XCV3190

1

824

S=3960 I=92 E=0

acyl-CoA dehydrogenase

XFF4834R

NP_638218.1 lcl|fadE-XCC2870

1

824

S=3893 I=90 E=0

acyl-CoA dehydrogenase

XFF4834R

lcl|XALc_2197

1

824

S=3489 I=80 E=0

putative acyl-coa dehydrogenase protein

XFF4834R

lcl|XALc_1764

154

478

S=162 I=24 E=3.80674e-12

putative acyl-coa dehydrogenase oxidoreductase protein

XFF4834R

YP_363336.1 lcl|acdA-XCV1605

154

478

S=159 I=24 E=1.00197e-11

acyl-CoA dehydrogenase

XFF4834R

NP_641895.1 lcl|acdA-XAC1562

154

478

S=159 I=24 E=1.00197e-11

acyl-CoA dehydrogenase

XFF4834R

NP_636886.1 lcl|acdA-XCC1514

154

478

S=159 I=24 E=1.03753e-11

acyl-CoA dehydrogenase

XFF4834R

lcl|XALc_0151

155

511

S=155 I=23 E=3.33728e-11

putative acyl-coa dehydrogenase protein

XFF4834R

YP_363095.1 lcl|XCV1364

216

480

S=149 I=25 E=1.4189e-10

acyl-CoA dehydrogenase

XFF4834R

NP_641648.1 lcl|fadE9-XAC1313

216

480

S=147 I=25 E=2.50078e-10

acyl-CoA dehydrogenase

XFF4834R

NP_635641.1 lcl|acdA-XCC0246

155

511

S=142 I=24 E=1.12035e-09

acyl-CoA dehydrogenase

XFF4834R

YP_362004.1 lcl|acdA-XCV0273

155

511

S=121 I=23 E=4.32053e-07

acyl-CoA dehydrogenase

XFF4834R

NP_640621.1 lcl|acdA-XAC0265

155

511

S=114 I=23 E=3.12661e-06

acyl-CoA dehydrogenase

pubmed

67

824

S=2060 I=52 E=0

Acyl-coenzyme A dehydrogenase EC=1.3.99.- ; FAD Fatty acid metabolism Flavoprotein Lipid Oxidoreductase

Pubmed 10206693

 

prodomImg

pubmed

67

743

S=2011 I=55 E=0

Acyl-CoA dehydrogenase

Pubmed 12057976

 

prodomImg

pubmed

7

716

S=1785 I=50 E=0

Very-long-chain acyl-coA dehydrogenase homolog

Pubmed 11207749,11872725

 

prodomImg

pubmed

296

399

S=327 I=58 E=2.16293e-30

Putative uroporphyrinogen-III C-methyltransferase EC=2.1.1.107 ; Cell inner membrane biosynthesis S-adenosyl-L-methionine Transmembrane

Pubmed 8874804

 

prodomImg

pubmed

102

508

S=265 I=27 E=6.45066e-23

Acyl-CoA dehydrogenase family member 9, mitochondrial EC=1.3.99.- ; Acetylation FAD Flavoprotein Mitochondrion Oxidoreductase Polymorphism T

Pubmed 12359260

 

prodomImg

sp_Pdown

sp|Q8ZBY6|FADE_YERPE

67

824

S=2094 I=53 E=0

Acyl-coenzyme A dehydrogenase EC=1.3.99.- ; FAD Fatty acid metabolism Flavoprotein Lipid Oxidoreductase

sp_Pdown

sp|Q8X7R2|FADE_ECO57

67

824

S=2074 I=53 E=0

Acyl-coenzyme A dehydrogenase EC=1.3.99.- ; FAD Fatty acid metabolism Flavoprotein Lipid Oxidoreductase

sp_Pdown

sp|Q47146|FADE_ECOLI

67

824

S=2074 I=52 E=0

Acyl-coenzyme A dehydrogenase EC=1.3.99.- ; FAD Fatty acid metabolism Flavoprotein Lipid Oxidoreductase

sp_Pdown

sp|Q8ZRJ7|FADE_SALTY

67

824

S=2060 I=52 E=0

Acyl-coenzyme A dehydrogenase EC=1.3.99.- ; FAD Fatty acid metabolism Flavoprotein Lipid Oxidoreductase

sp_Pdown

sp|Q8Z937|FADE_SALTI

67

824

S=2056 I=52 E=0

Acyl-coenzyme A dehydrogenase EC=1.3.99.- ; FAD Fatty acid metabolism Flavoprotein Lipid Oxidoreductase

Iprscan IPR013786 [G3DSA:1.10.540.10]

124

239

Acyl-CoA dehydrogenase/oxidase, N-terminal

Iprscan IPR006091 [G3DSA:2.40.110.10]

240

358

Acyl-CoA oxidase/dehydrogenase, central domain

Iprscan IPR013764 [G3DSA:1.20.140.10]

363

511

Acyl-CoA oxidase/dehydrogenase, type1/2, C-terminal

Iprscan [PTHR10909:SF10]

194

706

-

Iprscan [PTHR10909]

194

706

-

Iprscan IPR015396 [PF09317]

518

801

Protein of unknown function DUF1974

Iprscan IPR006090 [PF00441]

364

509

Acyl-CoA oxidase/dehydrogenase, type 1

Iprscan IPR006092 [PF02771]

137

236

Acyl-CoA dehydrogenase, N-terminal

Iprscan [seg]

45

65

-

Iprscan [seg]

195

210

-

Iprscan [seg]

428

441

-

Iprscan [seg]

780

790

-

Iprscan [SignalP-NN(euk)]

1

18

-

Iprscan [tmhmm]

2

19

-

Iprscan [tmhmm]

24

43

-

Iprscan [tmhmm]

45

67

-

PD703961

513

674

S=547 I=60 E=1.26116e-58

PD707090

263

372

S=437 I=71 E=2.61762e-45

PD597950

1

79

S=276 I=71 E=7.27127e-26

PD878467

442

512

S=266 I=65 E=1.33753e-24

PD705789

373

427

S=195 I=67 E=5.45526e-16

PD032527

80

125

S=190 I=74 E=2.12574e-15

PDA4B900

791

824

S=183 I=97 E=1.38551e-14

PDA1F9V6

123

160

S=168 I=79 E=8.26951e-13

PD000558

157

330

S=159 I=33 E=1.00973e-11

PD042730

713

815

S=148 I=35 E=2.54222e-10

Iprscan IPR009100 [SSF56645]

115

360

Acyl-CoA dehydrogenase/oxidase

Iprscan IPR009075 [SSF47203]

364

522

Acyl-CoA dehydrogenase/oxidase C-terminal

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one mgKfojPH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

70 hits
swiss-prot

Swiss-Prot ncbi-blastp

94 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr15840.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr15840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr15840.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr15840.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
fadA XFF4834R_chr21150
XFF4834R_chr21140
XFF4834R_chr21140
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr21160
XFF4834R_chr21160
ID fadA
AC XFF4834R_chr21150
LT XFF4834R_chr21150
OR XFF4834R_chr from 2453837 to 2455042 on strand -
DE probable acetyl-CoA acetyltransferase
IP Thiolase; Thiolase-like
CL 1.1.2.4 Anaerobic fatty acid oxidation pathway
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
transferring acyl groups other than amino-acyl groups (GO:0016747)

Curated
PM
AN ancien nom ds certaines publi YsiA
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100812)
MW 41912.8 Da
SQ 401 aa
 
........10........20........30........40........50
| | | | |
MSKQIQEAYIVAATRTPVGKAPKGVFRNTRPDDMLAHVLRAVVAQAPGID
TSRIDDAIIGCAMPEGEQGMNVARIGVLLAGLPNSVAGQTINRFCSSGIQ
AIAMAADQIRLGNADLMLAGGTESMSMVPMMGNKVAMAPSVFADDHVAIA
YGMGITAEKVAEEWKVSREDQDAFALASHQKAIAAIAAGEFRDEISPYEI
HSHQPDLAGNVIALRKRLVDTDEGPRPDSSLEGLAKLRPVFRNGQFGGSV
TAGNSSQMSDGAGAVLLASEQAIKDYGLTPLARFVSFSVAGVRPEVMGIG
PIAAIPKALKQAGLTKDQLDWIELNEAFAAQALAVIRDSELDPSKVNPLG
GAIALGHPLGATGAIRAATLVHGLRRRQQKYGMVTMCIGTGMGAAGIIEA
L
XFF4834R

XFF4834R_chr03500 lcl|paaJ-XFF4834R_chr03500

5

401

S=695 I=45 E=1.19879e-77

predicted beta-ketoadipyl CoA thiolase

XFF4834R

XFF4834R_chr31520 lcl|XFF4834R_chr34100398_3622573_f2_XFF4834R-XFF4834R_chr31520

5

399

S=518 I=38 E=3.69114e-56

predicted acyltransferase

XFF4834R

XFF4834R_chr01840 lcl|fadI-XFF4834R_chr01840

71

399

S=344 I=33 E=3.95739e-35

beta-ketoacyl-CoA thiolase, anaerobic, subunit

XFF4834R

YP_363794.1 lcl|fadA-XCV2063

1

401

S=2053 I=98 E=0

acetyl-CoA acetyltransferase

XFF4834R

NP_642338.1 lcl|fadA-XAC2012

1

401

S=2047 I=97 E=0

acetyl-CoA acetyltransferase

XFF4834R

NP_637343.1 lcl|fadA-XCC1978

1

401

S=2042 I=97 E=0

acetyl-CoA acetyltransferase

XFF4834R

lcl|fadA-XALc_1595

1

401

S=1895 I=90 E=0

probable acetyl-coa c-acyltransferase protein

XFF4834R

NP_635761.1 lcl|pcaF-XCC0366

5

399

S=738 I=45 E=3.16068e-82

beta-ketoadipyl CoA thiolase

XFF4834R

NP_640722.1 lcl|pcaF-XAC0366

5

401

S=684 I=44 E=9.43419e-76

beta-ketoadipyl CoA thiolase

XFF4834R

lcl|pcaF-XALc_3031

5

401

S=683 I=43 E=1.30258e-75

probable beta-ketoadipyl coa thiolase protein

XFF4834R

YP_362111.1 lcl|pcaF-XCV0380

5

401

S=683 I=44 E=1.43369e-75

beta-ketoadipyl CoA thiolase

XFF4834R

lcl|atoB-XALc_2525

5

399

S=530 I=37 E=4.95662e-57

probable acetyl-coa c-acetyltransferase protein

XFF4834R

YP_363132.1 lcl|thlA-XCV1401

5

401

S=528 I=38 E=8.36326e-57

acetyl-CoA C-acetyltransferase

XFF4834R

NP_641683.1 lcl|atoB-XAC1348

5

399

S=527 I=38 E=9.95647e-57

acetoacetyl-CoA thiolase

XFF4834R

NP_636671.1 lcl|atoB-XCC1297

5

399

S=511 I=37 E=1.01147e-54

acetoacetyl-CoA thiolase

XFF4834R

lcl|XALc_3086

153

399

S=356 I=36 E=6.78354e-36

putative acetyl-coa c-acyltransferase protein

XFF4834R

NP_640569.1 lcl|yfcY-XAC0213

71

399

S=345 I=33 E=1.45984e-34

acetyl-CoA acetyltransferase

XFF4834R

YP_361929.1 lcl|XCV0198

71

399

S=344 I=32 E=1.91288e-34

acetyl-CoA acetyltransferase

XFF4834R

NP_635589.1 lcl|yfcY-XCC0194

48

399

S=343 I=30 E=2.52846e-34

acetyl-CoA acetyltransferase

pubmed

5

399

S=957 I=50 E=3.34085e-107

Acetyl-CoA acethyltransferase homologue Acetyl-CoA acetyltransferase homologue

Pubmed 15901693

 

prodomImg

pubmed

5

399

S=954 I=50 E=8.27283e-107

Acetyl-CoA acetyltransferase homologue

Pubmed 15901693

 

prodomImg

pubmed

5

399

S=952 I=50 E=1.42042e-106

Acetyl-CoA acethyltransferase homologue

Pubmed 19001453

 

prodomImg

pubmed

5

399

S=950 I=50 E=3.0328e-106

Acetyl-CoA acetyltransferase homologue

Pubmed 15901693

 

prodomImg

pubmed

5

399

S=948 I=50 E=4.81424e-106

Acetyl-CoA acethyltransferase homologue

Pubmed 19001453

 

prodomImg

sp_Pdown

sp|O32177|FADA_BACSU

5

399

S=940 I=51 E=3.41495e-105

3-ketoacyl-CoA thiolase EC=2.3.1.16 ; Acyltransferase Fatty acid metabolism Lipid degradation

sp_Pdown

sp|B6EGU1|FADA_ALISL

5

399

S=794 I=45 E=1.30055e-87

3-ketoacyl-CoA thiolase EC=2.3.1.16 ; Acyltransferase Cytoplasm Fatty acid metabolism Lipid degradation

sp_Pdown

sp|P21775|THIKA_RAT

7

399

S=790 I=46 E=4.5644e-87

3-ketoacyl-CoA thiolase A, peroxisomal EC=2.3.1.16 ; Acyltransferase Alternative splicing Fatty acid metabolism Lipid Peroxisome Transit peptide

sp_Pdown

sp|Q921H8|THIKA_MOUSE

7

399

S=787 I=46 E=9.32991e-87

3-ketoacyl-CoA thiolase A, peroxisomal EC=2.3.1.16 ; Acyltransferase Fatty acid metabolism Lipid Peroxisome Transit peptide

sp_Pdown

sp|P07871|THIKB_RAT

7

399

S=786 I=46 E=1.41785e-86

3-ketoacyl-CoA thiolase B, peroxisomal EC=2.3.1.16 ; Acyltransferase Fatty acid metabolism Lipid Peroxisome Transit peptide

Iprscan IPR016038 [G3DSA:3.40.47.10]

6

284

Thiolase-like, subgroup

Iprscan IPR002155 [PIRSF000429]

5

401

Thiolase

Iprscan IPR002155 [PTHR18919]

71

401

Thiolase

Iprscan IPR020616 [PF00108]

6

271

Thiolase, N-terminal

Iprscan IPR020617 [PF02803]

278

399

Thiolase, C-terminal

Iprscan IPR002155 [TIGR01930]

10

399

Thiolase

Iprscan IPR020615 [PS00098]

91

109

Thiolase, acyl-enzyme intermediate active site

Iprscan IPR020610 [PS00099]

382

395

Thiolase, active site

Iprscan IPR020613 [PS00737]

347

363

Thiolase, conserved site

Iprscan [seg]

182

188

-

PDA8Z0A6

72

243

S=218 I=33 E=5.66098e-19

PD985894

86

399

S=187 I=28 E=3.0117e-15

PD859032

296

352

S=174 I=60 E=1.22483e-13

PDA5L2P0

123

276

S=157 I=31 E=1.5074e-11

PD858891

346

399

S=153 I=65 E=4.6418e-11

PD621605

250

297

S=141 I=58 E=1.42818e-09

PDA702A7

189

214

S=140 I=96 E=1.70025e-09

PD464408

6

270

S=130 I=26 E=2.67331e-08

PD542989

258

360

S=124 I=26 E=1.54219e-07

PDA0R2V3

126

150

S=122 I=96 E=2.28312e-07

Iprscan IPR016039 [SSF53901]

2

276

Thiolase-like

Iprscan IPR016039 [SSF53901]

277

401

Thiolase-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one Ypk0zSnj)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

238 hits
swiss-prot

Swiss-Prot ncbi-blastp

284 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr21150.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr21150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr21150.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBiPXxtC/XFF4834R_chr21150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.