Xanthomonas fuscans subsp. fuscans

3 hits

  1. XFF4834R_chr11320prpCXFF4834R_chr11320Probable 2-methylcitrate synthase
  2. XFF4834R_chr40260XFF4834R_chr_4652516_4653571_f2_XFF4834R-XFF4834R_chr40260XFF4834R_chr40260putative PrpF protein
  3. XFF4834R_chr40480acsAXFF4834R_chr40480probable acetyl-CoA synthetase

prpC XFF4834R_chr11320
XFF4834R_chr_1214
XFF4834R_chr_1214
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr11330
XFF4834R_chr11330
ID prpC
AC XFF4834R_chr11320
LT XFF4834R_chr11320
OR XFF4834R_chr from 1261369 to 1262523 on strand +
DE Probable 2-methylcitrate synthase
IP Citrate synthase-like
CL 1.1.2.3 Propionate degradation GO:0019543
EC
GO InterPro
Biological Process: tricarboxylic acid cycle (GO:0006099)
Biological Process: cellular carbohydrate metabolic process (GO:0044262)
Cellular Component: cytoplasm (GO:0005737)
acyl groups converted into alkyl on transfer (GO:0046912)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100817)
MW 42458.9 Da
SQ 384 aa
 
........10........20........30........40........50
| | | | |
MNDTATPGFKPKKSVALSGTAAGNTALCTVGRSGNDLHYRGYDILDLATT
SEFEEIAYLLVHGKLPNRSELRGYKAKLRSLRGVPAAVKTALEQLPPSAH
PMDVMRTGVSVLGCLQPEKDDHNHPGARDIADKLMASLGSMLLYWYHYSH
NGKRIEVETEDDSIGGHFLHLLHGFAPKDSWVRAMHTSLILYAEHEFNAS
TFASRVIAGTGSDMYSAIAGGIGALRGPKHGGANEVAFEVQKRYDTPDEA
EADIKARVERKEVVIGFGHPVYTVSDPRNKVIKDVARELSDEQGSRKMYD
IAERLESVMWDIKKMFPNLDWFSAVSYHMMGVPTAMFTPLFVLARTAGWS
AHIIEQRMDGKIIRPSANYTGPEDQVFVPLDQRS
XFF4834R

XFF4834R_chr12630 lcl|gltA-XFF4834R_chr12630

17

371

S=468 I=33 E=3.70271e-50

citrate synthase

XFF4834R

NP_641474.1 lcl|prpC-XAC1138

1

384

S=2043 I=99 E=0

methylcitrate synthase

XFF4834R

YP_362888.1 lcl|XCV1157

1

384

S=2030 I=98 E=0

methylcitrate synthase

XFF4834R

NP_636407.1 lcl|prpC-XCC1032

1

384

S=2015 I=97 E=0

methylcitrate synthase

XFF4834R

lcl|prpC-XALc_0640

1

383

S=1769 I=84 E=0

probable 2-methylcitrate synthase protein

XFF4834R

lcl|GltA-XALc_2356

17

383

S=472 I=32 E=5.18327e-50

putative citrate synthase protein

XFF4834R

YP_365235.1 lcl|gltA-XCV3504

17

371

S=468 I=33 E=1.40044e-49

type II citrate synthase

XFF4834R

NP_643695.1 lcl|gltA-XAC3388

17

371

S=468 I=33 E=1.40044e-49

type II citrate synthase

XFF4834R

NP_638581.1 lcl|gltA-XCC3235

17

371

S=466 I=33 E=3.01632e-49

type II citrate synthase

pubmed

2

383

S=1671 I=80 E=0

2-methylcitrate synthase ; Transferase

Pubmed 11772636

 

prodomImg

pubmed

12

383

S=1662 I=82 E=0

2-methylcitrate synthase 2 ; Transferase

Pubmed 12113928,16133321

 

prodomImg

pubmed

10

383

S=1656 I=81 E=0

Methylcitrate synthase ; Transferase

Pubmed 11495997

 

prodomImg

pubmed

9

384

S=1546 I=76 E=1.49959e-178

2-methylcitrate synthase EC=2.3.3.5 ; Transferase

Pubmed 9006051

 

prodomImg

pubmed

17

384

S=998 I=51 E=3.86797e-112

Citrate synthase ; Transferase

Pubmed 18004300

 

prodomImg

sp_Pdown

sp|P31660|PRPC_ECOLI

4

384

S=1551 I=76 E=2.61778e-179

2-methylcitrate synthase EC=2.3.3.5 ; Transferase

sp_Pdown

sp|Q56063|PRPC_SALTY

9

384

S=1546 I=76 E=1.02007e-178

2-methylcitrate synthase EC=2.3.3.5 ; Transferase

sp_Pdown

sp|P39120|CISY2_BACSU

17

384

S=692 I=39 E=3.37201e-75

Citrate synthase 2 EC=2.3.3.1 ; Allosteric enzyme Phosphoprotein Transferase Tricarboxylic acid cycle

sp_Pdown

sp|Q8NSL1|PRPC2_CORGL

17

383

S=665 I=40 E=6.24659e-72

2-methylcitrate synthase 2 EC=2.3.3.5 ; Transferase

sp_Pdown

sp|Q8NSH7|PRPC1_CORGL

17

384

S=662 I=39 E=1.56036e-71

2-methylcitrate synthase 1 EC=2.3.3.5 ; Transferase

Iprscan IPR002020 [PR00143]

134

147

Citrate synthase-like

Iprscan IPR002020 [PR00143]

184

199

Citrate synthase-like

Iprscan IPR002020 [PR00143]

206

234

Citrate synthase-like

Iprscan IPR002020 [PR00143]

259

279

Citrate synthase-like

Iprscan IPR002020 [PR00143]

316

332

Citrate synthase-like

Iprscan IPR002020 [PR00143]

336

350

Citrate synthase-like

Iprscan IPR016142 [G3DSA:1.10.580.10]

21

278

Citrate synthase-like, large alpha subdomain

Iprscan IPR002020 [PTHR11739]

17

383

Citrate synthase-like

Iprscan IPR002020 [PF00285]

17

365

Citrate synthase-like

Iprscan IPR011278 [TIGR01800]

15

383

2-methylcitrate synthase/citrate synthase type I

Iprscan IPR019810 [PS00480]

266

278

Citrate synthase active site

PD000990

17

378

S=710 I=43 E=1.47995e-78

PDA8C5W4

261

324

S=216 I=58 E=1.15185e-18

PD762271

1

36

S=154 I=86 E=3.74819e-11

PD714017

17

137

S=132 I=30 E=1.84513e-08

PDA4T8X5

25

96

S=122 I=38 E=3.33539e-07

PDA233T4

9

30

S=108 I=95 E=1.41691e-05

PDA3N468

9

30

S=106 I=91 E=2.49728e-05

PDA3U1M8

3

36

S=104 I=63 E=4.25053e-05

Iprscan IPR016141 [SSF48256]

13

383

Citrate synthase-like, core

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one WA4lnx65)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

636 hits
swiss-prot

Swiss-Prot ncbi-blastp

111 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr11320.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr11320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr11320.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr11320.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr_4652516_4653571_f2_XFF4834R-XFF4834R_chr40260 XFF4834R_chr40260
XFF4834R_chr40260
XFF4834R_chr40260
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr_4291
XFF4834R_chr_4291
ID XFF4834R_chr_4652516_4653571_f2_XFF4834R-XFF4834R_chr40260
AC XFF4834R_chr40260
LT XFF4834R_chr40260
OR XFF4834R_chr from 4652516 to 4653571 on strand +
DE putative PrpF protein
IP PrpF protein
CL 1.1.2.3 Propionate degradation GO:0019543
EC
GO InterPro


Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20100831)
MW 36454.2 Da
SQ 351 aa
 
........10........20........30........40........50
| | | | |
MSERVRAMWMRGGTSKGGFFLADELPADTAARDAFLLRAYGSPDARQIDG
MGRADPLTSKVAVVSRSTHADADVDYLFLQVAVEHAQVSDAQNCGNMLAG
VAPFALERGLLPIRNGQTQVRIFMRNTGTLATATVQTPDGKVRYDGDARI
DGVPGTAAPIALAFADIAGALCGVLLPSGHAVDTLDGVQVTLIDNGMPCV
VLRASDVGISGYEDRATLDADAALRARLETLRLQAGPLMHLGDVRDATVP
KMMLVAAPRAGGAISARSFIPHRCHASIGVLGAVTVATACLLPGSPAHAL
AQVPGGRSQRLDVEHPSGASSCLIDLDAQGAVVGAAVVRTARKLFDGELY
G
XFF4834R

XFF4834R_chr11350 XFF4834R_chr11820977_1267176_f1_XFF4834R-XFF4834R_chr11350

4

211

S=353 I=42 E=3.18621e-36

XFF4834R

NP_644455.1 fldA-XAC4156

1

351

S=1511 I=85 E=5.65449e-176

FldA protein

XFF4834R

YP_365985.1 XCV4254

8

351

S=1424 I=82 E=2.02015e-165

hypothetical protein

XFF4834R

NP_639370.1 fldA-XCC4031

1

351

S=1264 I=72 E=4.63215e-146

FldA protein

XFF4834R

XALc_0642 XALc_0642

4

211

S=343 I=42 E=1.67415e-34

hypothetical protein

XFF4834R

NP_641478.1 XAC1142-XAC1142

4

211

S=339 I=42 E=5.92703e-34

hypothetical protein

XFF4834R

YP_362891.1 XCV1160

4

211

S=329 I=42 E=9.56604e-33

hypothetical protein

XFF4834R

NP_636411.1 XCC1036

4

211

S=324 I=39 E=4.06717e-32

hypothetical protein

pubmed

6

350

S=1078 I=60 E=6.57757e-122

FldA protein

Pubmed 11766961

 

prodomImg

pubmed

5

351

S=1050 I=59 E=1.54189e-118

ORF1 protein

Pubmed 9864312,2185230

 

prodomImg

pubmed

4

211

S=457 I=44 E=1.13742e-46

3-methylitaconate isomerase

Pubmed 16894175

 

prodomImg

pubmed

10

350

S=428 I=32 E=4.57797e-43

Uncharacterized protein yraM

Pubmed 9141695,9308178

 

prodomImg

pubmed

5

350

S=366 I=33 E=1.43864e-35

Putative uncharacterized protein

Pubmed 16549670

 

prodomImg

sp_Pdown

acc=P0AAW0

3

350

S=667 I=40 E=3.00424e-72

Uncharacterized protein ybhH

sp_Pdown

acc=P0AAV8

3

350

S=667 I=40 E=3.00424e-72

Uncharacterized protein ybhH

sp_Pdown

acc=P0AAV9

3

350

S=667 I=40 E=3.00424e-72

Uncharacterized protein ybhH

sp_Pdown

acc=O07931

10

350

S=428 I=32 E=3.1169e-43

Uncharacterized protein yraM

Iprscan IPR007400 [PF04303]

4

350

PrpF protein

Iprscan [seg]

157

171

-

Iprscan [seg]

213

233

-

Iprscan [seg]

328

338

-

PD698211

120

350

S=252 I=32 E=4.23198e-23

PD041524

1

61

S=156 I=57 E=2.04974e-11

PDA1F9C6

62

111

S=138 I=52 E=2.63501e-09

PDA95922

11

111

S=127 I=34 E=5.77038e-08

Iprscan [SSF54506]

45

273

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one qksTT2bv)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

8 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr40260.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr40260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr40260.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr40260.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
acsA XFF4834R_chr40480
XFF4834R_chr40470
XFF4834R_chr40470
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40490
XFF4834R_chr40490
ID acsA
AC XFF4834R_chr40480
LT XFF4834R_chr40480
OR XFF4834R_chr from 4680820 to 4682763 on strand +
DE probable acetyl-CoA synthetase
IP Acetate--CoA ligase
CL 1.1.2.3 Propionate degradation GO:0019543
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: AMP binding (GO:0016208)
Molecular Function: acetate-CoA ligase activity (GO:0003987)

Curated
PM
AN publi sur genprotec. gene deja nomme acs j'ai rajoute acsA pour suivre xav (chez genprotec les 2 existent)
CC COG: [I] Lipid transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by brin (20100823)
MW 71349.3 Da
SQ 647 aa
 
........10........20........30........40........50
| | | | |
MADVYPVDPAFAADARVTREQYAALYRESIEHPEQFWGKAAQRLEWFKQP
TQIKDVSYALDDFHIRWFGDGELNASVNCLDRQLATRGDKTALLFEPDSP
DAQSYPVTYRELYERVCKLGNALRNLGVKKGDRVTIYLPMIVDAAVAMLA
CARIGAVHSVVFGGFAANSIADRVIDCQSKLIITADEGLRGGKKIPLKAN
VDAALKIPGTNTVETVLVVRHTGGAVEMQAPRDRWFHDVVDGQPAACEPE
RMNAEDPLFILYTSGSTGKPKGVLHTTAGYLLFASYTHEVVFDLREDDIY
WCTADVGWVTGHSYIVYGPLANGATAVMFEGVPNYPNVSRFWEVIDKHQV
TIFYTAPTAIRALMRDGEAPVKKTSRKSLRLLGSVGEPINPEAWRWYYEV
VGDSRCPIVDTWWQTETGGILISPLAGAVDLKPGSATLPFFGVQPALVDA
EGKILEGATEGNLVLLDSWPGQMRSVYGDHQRFIDTYFRTYPGSYFTGDG
CRRDADGYYWITGRVDDVINVSGHRIGTAEVESALVSHPKVAEAAVVGFP
HDVKGQGIYAYVTLIAGETPSEDLHKELVSWVRKEIGPIASPDHLQWAPG
LPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPSVVDSLVNERLAR
XFF4834R

XFF4834R_chr20200 lcl|fadD-XFF4834R_chr20200

98

615

S=191 I=24 E=2.74437e-16

acyl-CoA synthetase (long-chain-fatty-acid--CoA ligase)

XFF4834R

XFF4834R_chr38100 lcl|XFF4834R_chr41190322_4401866_r2_XFF4834R-XFF4834R_chr38100

495

614

S=163 I=37 E=6.66159e-13

XFF4834R

XFF4834R_chr39720 lcl|XFF4834R_chr_4572602_4573963_r3_XFF4834R-XFF4834R_chr39720

506

614

S=109 I=25 E=2.34663e-06

XFF4834R

NP_644478.1 lcl|acs-XAC4179

1

647

S=3420 I=99 E=0

acetyl-CoA synthetase

XFF4834R

YP_366006.1 lcl|acsA-XCV4275

1

647

S=3408 I=99 E=0

acetyl-CoA synthetase

XFF4834R

NP_639399.1 lcl|acs-XCC4060

1

647

S=3392 I=98 E=0

acetyl-CoA synthetase

XFF4834R

lcl|acsA-XALc_0092

1

647

S=3134 I=89 E=0

probable acetyl-coenzyme a synthetase protein

XFF4834R

NP_636198.1 lcl|XCC0807

259

620

S=245 I=27 E=2.73182e-22

acyl-CoA synthetase

XFF4834R

NP_641233.1 lcl|XAC0881-XAC0881

259

615

S=228 I=26 E=3.10831e-20

acyl-CoA synthetase

XFF4834R

lcl|XALc_1551

107

614

S=227 I=25 E=4.80673e-20

probable non-ribosomal peptide synthetase protein

XFF4834R

lcl|XALc_1551

107

549

S=172 I=24 E=2.08734e-13

probable non-ribosomal peptide synthetase protein

XFF4834R

lcl|XALc_1551

107

549

S=164 I=25 E=1.66257e-12

probable non-ribosomal peptide synthetase protein

XFF4834R

lcl|XALc_1551

107

547

S=163 I=25 E=2.37699e-12

probable non-ribosomal peptide synthetase protein

pubmed

4

644

S=2399 I=69 E=0

Acetyl-coenzyme A synthetase EC=6.2.1.1 ; Acetylation ATP-binding Ligase Nucleotide-binding

Pubmed 11726281

 

prodomImg

pubmed

4

647

S=2296 I=67 E=0

Acetyl-coenzyme A synthetase EC=6.2.1.1 ; Acetylation ATP-binding Ligase Nucleotide-binding Plasmid

Pubmed 10907845,11273700

 

prodomImg

pubmed

2

646

S=2277 I=65 E=0

Acetyl-coenzyme A synthetase

Pubmed 15262943

 

prodomImg

pubmed

9

646

S=2189 I=62 E=0

Acetyl-coenzyme A synthetase EC=6.2.1.1 ; Acetylation ATP-binding Ligase Nucleotide-binding

Pubmed 8265357

 

prodomImg

pubmed

9

646

S=2172 I=62 E=0

Acetyl-coenzyme A synthetase EC=6.2.1.1 ; Acetylation ATP-binding Ligase Nucleotide-binding

Pubmed 12493915

 

prodomImg

sp_Pdown

sp|Q8PF09|ACSA_XANAC

1

647

S=3420 I=99 E=0

Acetyl-coenzyme A synthetase EC=6.2.1.1 ; Acetylation ATP-binding Ligase Nucleotide-binding

sp_Pdown

sp|Q2NXE2|ACSA_XANOM

1

647

S=3398 I=98 E=0

Acetyl-coenzyme A synthetase EC=6.2.1.1 ; Acetylation ATP-binding Ligase Nucleotide-binding

sp_Pdown

sp|Q8P3L1|ACSA_XANCP

1

647

S=3392 I=98 E=0

Acetyl-coenzyme A synthetase EC=6.2.1.1 ; Acetylation ATP-binding Ligase Nucleotide-binding

sp_Pdown

sp|Q4UP35|ACSA_XANC8

1

647

S=3392 I=98 E=0

Acetyl-coenzyme A synthetase EC=6.2.1.1 ; Acetylation ATP-binding Ligase Nucleotide-binding

sp_Pdown

sp|Q9PB89|ACSA_XYLFA

1

647

S=2908 I=81 E=0

Acetyl-coenzyme A synthetase EC=6.2.1.1 ; Acetylation ATP-binding Ligase Nucleotide-binding

Iprscan [G3DSA:3.40.50.980]

77

273

-

Iprscan [G3DSA:3.40.50.980]

277

421

-

Iprscan [G3DSA:2.30.38.10]

432

515

-

Iprscan [G3DSA:3.30.300.30]

516

628

-

Iprscan [MF_01123]

1

644

-

Iprscan [PTHR11968:SF42]

24

647

-

Iprscan [PTHR11968]

24

647

-

Iprscan IPR000873 [PF00501]

108

546

AMP-dependent synthetase/ligase

Iprscan [PF11930]

18

100

-

Iprscan IPR011904 [TIGR02188]

16

643

Acetate--CoA ligase

Iprscan IPR020845 [PS00455]

260

271

AMP-binding, conserved site

PD857560

304

380

S=229 I=57 E=4.36423e-20

PD922783

285

492

S=198 I=28 E=2.18435e-16

PD826971

286

502

S=195 I=28 E=5.74943e-16

PDA0Z624

320

580

S=194 I=30 E=7.2123e-16

PD167005

394

442

S=184 I=71 E=1.10471e-14

PD186254

589

633

S=155 I=69 E=4.00465e-11

PDA1F6P3

281

319

S=151 I=65 E=1.18057e-10

PD925981

293

399

S=145 I=35 E=5.15241e-10

PDA99798

541

621

S=135 I=43 E=9.72888e-09

PD794012

250

322

S=133 I=38 E=1.51766e-08

Iprscan [SSF56801]

3

646

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 4LXqoD0v)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

4 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr40480.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr40480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr40480.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBcsXhKE/XFF4834R_chr40480.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.