Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr09150pipXFF4834R_chr09150putative proline iminopeptidase
  2. XFF4834R_chr16990XFF4834R_chr18180714_1951043_r2_XFF4834R-XFF4834R_chr16990XFF4834R_chr16990probable dioxygenase system ferredoxin subunit

pip XFF4834R_chr09150
XFF4834R_chr09140
XFF4834R_chr09140
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr09160
XFF4834R_chr09160
ID pip
AC XFF4834R_chr09150
LT XFF4834R_chr09150
OR XFF4834R_chr from 1054106 to 1055047 on strand +
DE putative proline iminopeptidase
IP Alpha/beta hydrolase fold-1; Peptidase S33, proline iminopeptidase 1
CL 1.1.2.2 3-phenylpropionate and 3-(3-hydroxyphenyl)propionate degradation GO:0019380 GO:0019622
EC
GO InterPro
Cellular Component: cytoplasm (GO:0005737)
Molecular Function: aminopeptidase activity (GO:0004177)

Curated
PM
AN
CC COG: [R] General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by pieretti (20100504)
MW 35496.6 Da
SQ 313 aa
 
........10........20........30........40........50
| | | | |
MRTLYPEITPYQQGSLKVDDRHTLYFEQCGNPQGKPVVMLHGGPGGGCND
KMRRFHDPAKYRIVLFDQRGSGRSTPHADLVDNTTWDLVADIERLRTHLG
IDRWQVFGGSWGSTLALAYAQTHPQQVTELVLRGIFLLRRFELEWFYQEG
ASRLFPDAWEHYLNAIPPVERADLMSAFHRRLTSDDQATRLAAAKAWSVW
EGATSFLHVDEDFVTGHEDARFALAFARIENHYFVNGGFFEVEDQLLRDA
HRIADIPGVIVHGRYDVVCPLQSAWDLHKAWPKAQLQISPASGHSAFEPE
NVDALVRATDGFA
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr16470 lcl|XFF4834R_chr17720584_1903525_f2_XFF4834R-XFF4834R_chr16470

36

132

S=121 I=35 E=3.26078e-08

XFF4834R

XFF4834R_chr16030 lcl|XFF4834R_chr17240879_1851874_r3_XFF4834R-XFF4834R_chr16030

30

132

S=98 I=32 E=2.10334e-05

XFF4834R

XFF4834R_chr16470 lcl|XFF4834R_chr17720584_1903525_f2_XFF4834R-XFF4834R_chr16470

36

132

S=121 I=35 E=3.26078e-08

XFF4834R

XFF4834R_chr16030 lcl|XFF4834R_chr17240879_1851874_r3_XFF4834R-XFF4834R_chr16030

30

132

S=98 I=32 E=2.10334e-05

XFF4834R

NP_641261.1 lcl|pip-XAC0909

1

313

S=1653 I=99 E=0

proline imino-peptidase, chain A

XFF4834R

YP_362676.1 lcl|pip-XCV0945

1

313

S=1617 I=96 E=0

putative proline imino-peptidase

XFF4834R

NP_636227.1 lcl|pip-XCC0836

1

313

S=1531 I=90 E=1.83502e-178

proline iminopeptidase chain A

XFF4834R

lcl|pip-XALc_0462

1

313

S=1454 I=87 E=4.06195e-169

probable proline iminopeptidase (pip) protein

XFF4834R

NP_638165.1 lcl|XCC2817

36

132

S=130 I=35 E=1.13321e-08

proline imino-peptidase

XFF4834R

YP_364865.1 lcl|pip-XCV3134

36

132

S=122 I=34 E=9.42829e-08

prolyl aminopeptidase

XFF4834R

NP_643296.1 lcl|XAC2987-XAC2987

36

132

S=121 I=35 E=1.26816e-07

proline imino-peptidase

XFF4834R

lcl|XALc_3006

21

136

S=116 I=28 E=4.81403e-07

hypothetical hydrolase precursor protein

XFF4834R

NP_643678.1 lcl|XAC3371-XAC3371

23

125

S=102 I=31 E=2.2905e-05

proline imino-peptidase

pubmed

1

313

S=1597 I=96 E=0

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

Pubmed 8885412,8870654

 

prodomImg

pubmed

1

313

S=922 I=57 E=3.90425e-103

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

Pubmed 9348090,11011150

 

prodomImg

pubmed

4

313

S=802 I=51 E=1.58443e-88

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12823802

 

prodomImg

pubmed

4

310

S=771 I=50 E=7.9303e-85

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

Pubmed 7934933

 

prodomImg

pubmed

31

309

S=721 I=51 E=1.07063e-78

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=717 I=51 E=2.69781e-78

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=716 I=51 E=3.59721e-78

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=713 I=51 E=9.71912e-78

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=712 I=51 E=1.06974e-77

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

pubmed

31

309

S=712 I=51 E=1.15706e-77

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Hydrolase Protease

Pubmed 12517848

 

prodomImg

sp_Pdown

sp|P52279|PIP_XANCI

1

313

S=1597 I=96 E=0

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

sp_Pdown

sp|Q87DF8|PIP_XYLFT

1

312

S=1415 I=82 E=5.29539e-163

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

sp_Pdown

sp|Q9PD69|PIP_XYLFA

1

313

S=1397 I=80 E=8.39185e-161

Proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

sp_Pdown

sp|O83041|PIP_PLEBO

1

313

S=1039 I=64 E=1.98734e-117

Probable proline iminopeptidase EC=3.4.11.5 ; Aminopeptidase Cytoplasm Hydrolase Protease

sp_Pdown

sp|P93732|PIP_ARATH

2

310

S=977 I=60 E=6.29998e-110

Proline iminopeptidase EC=3.4.11.5 ; Alternative splicing Aminopeptidase Cytoplasm Hydrolase Protease

PD011214

9

313

S=873 I=56 E=2.60376e-98

PD330619

22

132

S=157 I=36 E=1.72336e-11

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one zxx8hqSH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

51 hits
swiss-prot

Swiss-Prot ncbi-blastp

29 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaXM_BO/XFF4834R_chr09150.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaXM_BO/XFF4834R_chr09150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaXM_BO/XFF4834R_chr09150.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaXM_BO/XFF4834R_chr09150.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr18180714_1951043_r2_XFF4834R-XFF4834R_chr16990 XFF4834R_chr16990
XFF4834R_chr_1821
XFF4834R_chr_1821
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr17000
XFF4834R_chr17000
ID XFF4834R_chr18180714_1951043_r2_XFF4834R-XFF4834R_chr16990
AC XFF4834R_chr16990
LT XFF4834R_chr16990
OR XFF4834R_chr from 1950714 to 1951043 on strand -
DE probable dioxygenase system ferredoxin subunit
IP Rieske [2Fe-2S] iron-sulphur domain
CL 1.1.2.2 3-phenylpropionate and 3-(3-hydroxyphenyl)propionate degradation GO:0019380 GO:0019622
EC
GO InterPro
2 sulfur cluster binding (GO:0051537)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [PR] Inorganic ion transport and metabolism;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by cverniere (20100802)
MW 12207.4 Da
SQ 109 aa
 
........10........20........30........40........50
| | | | |
MSDTWTFVCASDALLPGEMQTVWDEVTDTPIVVFNLDGALYALEDRCSHE
DYELSPGSFDPAAGTIECQLHSARFDVRDGRPLCAPAYTAVPKFPVKREH
DGIWTRDDR
Show or not Domain decomposition
 
XFF4834R

YP_364815.1 lcl|XCV3084

1

109

S=573 I=98 E=3.62493e-63

putative benzene 1,2-dioxygenase system ferredoxin component

XFF4834R

NP_643249.1 lcl|bedB-XAC2940

1

109

S=573 I=98 E=3.62493e-63

benzene 1,2-dioxygenase ferredoxin protein

XFF4834R

NP_638119.1 lcl|bedB-XCC2771

1

109

S=514 I=86 E=5.19749e-56

benzene 1,2-dioxygenase, ferredoxin protein

XFF4834R

lcl|hcaC-XALc_1025

1

109

S=459 I=78 E=2.29673e-49

probable 3-phenylpropionate dioxygenase ferredoxin subunit (digoxigenin ferredoxin subunit) protein

XFF4834R

NP_637373.1 lcl|nasE-XCC2008

3

105

S=125 I=34 E=7.72811e-09

nitrite assimilation small subunit

XFF4834R

YP_363825.1 lcl|nasE-XCV2094

4

104

S=124 I=33 E=9.61028e-09

nitrite reductase [NAD(P)H] small subunit

pubmed

4

103

S=178 I=38 E=8.91358e-14

Benzene 1,2-dioxygenase system ferredoxin subunit ; 2Fe-2S Aromatic hydrocarbons catabolism Electron transport Iron Iron-sulfur Metal-binding Plasmid

Pubmed 8344526

 

prodomImg

pubmed

4

103

S=177 I=39 E=1.06116e-13

Ferredoxin Toluene dioxygenase ferredoxin component Toluene dioxygenase iron-sulfur protein TobB Toluene dioxygenase iron-sulfur protein comp

Pubmed 16728956,19744988

 

prodomImg

pubmed

4

103

S=177 I=39 E=1.06116e-13

Toluene 1,2-dioxygenase system ferredoxin subunit ; 2Fe-2S Aromatic hydrocarbons catabolism Electron transport Iron Iron-sulfur Metal-binding

Pubmed 3667527

 

prodomImg

pubmed

4

103

S=177 I=39 E=1.06116e-13

Toluene 1,2-dioxygenase system ferredoxin subunit ; 2Fe-2S Aromatic hydrocarbons catabolism Electron transport Iron Iron-sulfur Metal-binding

Pubmed 2670929

 

prodomImg

pubmed

4

103

S=177 I=39 E=1.24148e-13

Benzene 1,2-dioxygenase system ferredoxin subunit ; 2Fe-2S Aromatic hydrocarbons catabolism Electron transport Iron Iron-sulfur Metal-binding

Pubmed 3667527,3360142

 

prodomImg

sp_Pdown

sp|Q07947|BEDB_PSEPU

4

103

S=178 I=38 E=6.15414e-14

Benzene 1,2-dioxygenase system ferredoxin subunit ; 2Fe-2S Aromatic hydrocarbons catabolism Electron transport Iron Iron-sulfur Metal-binding Plasmid

sp_Pdown

sp|P0C620|TODB_PSEPU

4

103

S=177 I=39 E=7.32652e-14

Toluene 1,2-dioxygenase system ferredoxin subunit ; 2Fe-2S Aromatic hydrocarbons catabolism Electron transport Iron Iron-sulfur Metal-binding

sp_Pdown

sp|A5W4F0|TODB_PSEP1

4

103

S=177 I=39 E=7.32652e-14

Toluene 1,2-dioxygenase system ferredoxin subunit ; 2Fe-2S Aromatic hydrocarbons catabolism Electron transport Iron Iron-sulfur Metal-binding

sp_Pdown

sp|P08086|BNZC_PSEPU

4

103

S=177 I=39 E=8.57146e-14

Benzene 1,2-dioxygenase system ferredoxin subunit ; 2Fe-2S Aromatic hydrocarbons catabolism Electron transport Iron Iron-sulfur Metal-binding

sp_Pdown

sp|P37332|BPHF_BURXL

5

105

S=152 I=35 E=7.24474e-11

Biphenyl dioxygenase system ferredoxin subunit ; 2Fe-2S Aromatic hydrocarbons catabolism Electron transport Iron Iron-sulfur Metal-binding

Iprscan IPR017941 [G3DSA:2.102.10.10]

4

105

Rieske [2Fe-2S] iron-sulphur domain

Iprscan [PTHR21496]

26

109

-

Iprscan IPR017941 [PF00355]

5

100

Rieske [2Fe-2S] iron-sulphur domain

Iprscan IPR017941 [PS51296]

6

105

Rieske [2Fe-2S] iron-sulphur domain

PDA1M0X2

1

31

S=147 I=90 E=2.18669e-10

Iprscan IPR017941 [SSF50022]

3

105

Rieske [2Fe-2S] iron-sulphur domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one jBSOP0DH)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

81 hits
swiss-prot

Swiss-Prot ncbi-blastp

20 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaXM_BO/XFF4834R_chr16990.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaXM_BO/XFF4834R_chr16990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaXM_BO/XFF4834R_chr16990.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBaXM_BO/XFF4834R_chr16990.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.